SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452996|ref|YP_007720744.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452996|ref|YP_007720744.1|
Domain Number 1 Region: 89-297
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 6.75e-51
Family MurCDEF 0.00011
Further Details:      
 
Domain Number 2 Region: 561-785
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.24e-48
Family ATP-binding domain of peptide synthetases 0.001
Further Details:      
 
Domain Number 3 Region: 298-441
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 3.11e-32
Family MurCDEF C-terminal domain 0.00077
Further Details:      
 
Domain Number 4 Region: 446-560
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.76e-30
Family D-Alanine ligase N-terminal domain 0.0011
Further Details:      
 
Domain Number 5 Region: 6-90
Classification Level Classification E-value
Superfamily MurCD N-terminal domain 4.71e-24
Family MurCD N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478452996|ref|YP_007720744.1|
Sequence length 802
Comment bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase [Chlamydia trachomatis L2b/Canada1]
Sequence
MKSLFYHFIGIGGIGMSALAHVLLDRGYSVSGSDLSEGKVVEKLKNKGAEFFLGNQEEHI
PEGAVVVYSSSISKENPEFLSAKSRGNRVVHRAELLAELAQDQISIFVTGSHGKTTVSSL
ITAILQEAKKNPSFAIGGLNQEGINGGSGSEYFVAEADESDGSIRCYTPEFSVITNIDDE
HLSNFEGDRELLLASLKDFALKTQQICWYNGDCPRLRSCLQGHTFGLDSSCDLHILSYYQ
EGWRLYFTAKYQDVVYADIEVQLVGMHNVLNAAAAMGIALSLGIDEGAIRNAFRGFSGVQ
RRLQRKNSSETFLFLEDYAHHPSEISCTLRAVRTAVGQRRILAICQPHRFSRLRECIDSF
PSAFKDADEVLLTEVYSAGEEAEDISYQELAEAISQESIVKCTHIPFHELQRHLEQSIRV
HDVCVSLGAGNIVNLGEKLRDFEPQKLHLGIICGGKSCEHEISVLSAKNIAKHLSKSFYD
VSYFLITREGLWESVSSLETAEDSGKSVFDPEIAQRLEKVDVVLPILHGPYGEDGAMQGF
LETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYLPLTLAGWKQEQDKWLAHIVE
AFSFPMFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFVEENRLGCKEIEVSVLG
DGSGAFVIAGLHERRGSGGFIDYQEKYGLSGKSSAQIVFDTDLSKEIQEQILEAADKIYR
LLLGKGSCRIDFFVDEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVHQLVIDGL
QRFNQRQRLISTSFVDQAFAIQ
Download sequence
Identical sequences A0A0E9FWJ1
gi|478452096|ref|YP_007715402.1| gi|478452996|ref|YP_007720744.1| gi|478453909|ref|YP_007718071.1| gi|478468330|ref|YP_007743203.1| gi|478454801|ref|YP_007717180.1| gi|478471039|ref|YP_007729680.1| gi|478464731|ref|YP_007741423.1| gi|478471930|ref|YP_007740533.1| gi|478465631|ref|YP_007742313.1| gi|478448497|ref|YP_007722531.1| gi|478467430|ref|YP_007718962.1| gi|478447604|ref|YP_007716292.1| gi|478470139|ref|YP_007723419.1| gi|478462935|ref|YP_007738756.1| gi|478451196|ref|YP_007721638.1| gi|478450295|ref|YP_007719852.1| gi|339625513|ref|YP_004716992.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]