SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453006|ref|YP_007720754.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453006|ref|YP_007720754.1|
Domain Number 1 Region: 8-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.4e-47
Family Inorganic pyrophosphatase 0.0000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478453006|ref|YP_007720754.1|
Sequence length 209
Comment inorganic pyrophosphatase [Chlamydia trachomatis L2b/Canada1]
Sequence
MSKTPLSIAHPWHGPVLTRDDYESLCCYIEITPADSVKFELDKETGILKVDRPQKFSNFC
PCLYGLLPKTYCGDLSGEYSGQQSNRENIKGDGDPLDICVLTEKNITQGNILLQARPIGG
IRILDSEEADDKIIAVLEDDLVYGNIEDISECPGTVLDMIQHYFLTYKATPESLIQAKPA
KIEIVGLYGKKEAQKVIRLAHEDYCNLFM
Download sequence
Identical sequences A0A0E9G1V4 B0B8Z8 B0BAM7 G4NPJ1 O84777 Q3KKS0
gi|478453006|ref|YP_007720754.1| gi|478454811|ref|YP_007717190.1| gi|15605505|ref|NP_220291.1| gi|478447614|ref|YP_007716302.1| gi|482546178|ref|YP_007852094.1| gi|478453919|ref|YP_007718081.1| gi|385245778|ref|YP_005814601.1| gi|478465641|ref|YP_007742323.1| gi|385270503|ref|YP_005813663.1| gi|478449409|ref|YP_007724332.1| gi|568112046|ref|YP_008921656.1| gi|527318621|ref|YP_008344823.1| gi|478459337|ref|YP_007732521.1| gi|237803202|ref|YP_002888396.1| gi|478475557|ref|YP_007725226.1| gi|478470149|ref|YP_007723429.1| gi|478457525|ref|YP_007726118.1| gi|527328176|ref|YP_008354367.1| gi|527324270|ref|YP_008350466.1| gi|478448507|ref|YP_007722541.1| gi|237805123|ref|YP_002889277.1| gi|386263128|ref|YP_005816407.1| gi|527319578|ref|YP_008345779.1| gi|478471940|ref|YP_007740543.1| gi|339625524|ref|YP_004717003.1| gi|478461142|ref|YP_007736093.1| gi|478462945|ref|YP_007738766.1| gi|478467440|ref|YP_007718972.1| gi|527322387|ref|YP_008348585.1| NP_220291.1.57406 WP_009872152.1.100466 WP_009872152.1.100644 WP_009872152.1.100883 WP_009872152.1.101362 WP_009872152.1.101735 WP_009872152.1.102133 WP_009872152.1.11148 WP_009872152.1.11717 WP_009872152.1.11732 WP_009872152.1.13674 WP_009872152.1.13766 WP_009872152.1.13837 WP_009872152.1.1409 WP_009872152.1.14786 WP_009872152.1.14984 WP_009872152.1.15381 WP_009872152.1.17082 WP_009872152.1.17422 WP_009872152.1.18643 WP_009872152.1.1923 WP_009872152.1.19304 WP_009872152.1.20022 WP_009872152.1.20093 WP_009872152.1.22210 WP_009872152.1.25195 WP_009872152.1.25246 WP_009872152.1.27753 WP_009872152.1.27980 WP_009872152.1.28239 WP_009872152.1.29171 WP_009872152.1.30792 WP_009872152.1.31128 WP_009872152.1.31373 WP_009872152.1.32156 WP_009872152.1.32801 WP_009872152.1.32856 WP_009872152.1.34934 WP_009872152.1.35043 WP_009872152.1.36244 WP_009872152.1.36518 WP_009872152.1.3661 WP_009872152.1.37417 WP_009872152.1.37673 WP_009872152.1.37956 WP_009872152.1.38181 WP_009872152.1.38504 WP_009872152.1.38794 WP_009872152.1.38813 WP_009872152.1.39258 WP_009872152.1.40272 WP_009872152.1.40464 WP_009872152.1.40808 WP_009872152.1.4187 WP_009872152.1.4264 WP_009872152.1.42718 WP_009872152.1.42889 WP_009872152.1.44223 WP_009872152.1.45552 WP_009872152.1.48551 WP_009872152.1.48923 WP_009872152.1.4939 WP_009872152.1.49465 WP_009872152.1.5036 WP_009872152.1.51159 WP_009872152.1.51530 WP_009872152.1.52091 WP_009872152.1.53299 WP_009872152.1.5416 WP_009872152.1.55117 WP_009872152.1.57520 WP_009872152.1.57533 WP_009872152.1.58046 WP_009872152.1.58308 WP_009872152.1.5967 WP_009872152.1.60427 WP_009872152.1.60937 WP_009872152.1.61004 WP_009872152.1.6151 WP_009872152.1.62239 WP_009872152.1.62489 WP_009872152.1.62510 WP_009872152.1.62968 WP_009872152.1.64162 WP_009872152.1.65182 WP_009872152.1.65391 WP_009872152.1.66489 WP_009872152.1.67104 WP_009872152.1.67250 WP_009872152.1.69355 WP_009872152.1.69519 WP_009872152.1.69991 WP_009872152.1.71307 WP_009872152.1.71619 WP_009872152.1.71686 WP_009872152.1.72034 WP_009872152.1.72164 WP_009872152.1.72442 WP_009872152.1.74323 WP_009872152.1.74635 WP_009872152.1.75470 WP_009872152.1.77153 WP_009872152.1.77651 WP_009872152.1.78375 WP_009872152.1.79775 WP_009872152.1.83642 WP_009872152.1.85256 WP_009872152.1.85365 WP_009872152.1.86066 WP_009872152.1.87079 WP_009872152.1.87298 WP_009872152.1.87666 WP_009872152.1.88177 WP_009872152.1.88937 WP_009872152.1.9107 WP_009872152.1.92427 WP_009872152.1.93216 WP_009872152.1.9343 WP_009872152.1.93600 WP_009872152.1.95142 WP_009872152.1.96955 WP_009872152.1.97423 WP_009872152.1.97602 WP_009872152.1.99598 YP_001654232.1.27483 gi|527329102|ref|YP_008355292.1| gi|478471049|ref|YP_007729690.1| gi|385243093|ref|YP_005810932.1| gi|76789514|ref|YP_328600.1| gi|478462038|ref|YP_007736988.1| gi|166154989|ref|YP_001653244.1| gi|385270503|ref|YP_005813663.1| gi|389859343|ref|YP_006361584.1| gi|478428908|ref|YP_007541348.1| gi|478464741|ref|YP_007741433.1| gi|527325403|ref|YP_008351597.1| gi|527321451|ref|YP_008347650.1| gi|389860219|ref|YP_006362459.1| gi|478452106|ref|YP_007715412.1| gi|385241242|ref|YP_005809083.1| gi|478451206|ref|YP_007721648.1| gi|478458435|ref|YP_007731620.1| gi|482545236|ref|YP_007851154.1| gi|527323344|ref|YP_008349541.1| gi|385243979|ref|YP_005811825.1| gi|478450305|ref|YP_007719862.1| gi|527327250|ref|YP_008353442.1| gi|385244859|ref|YP_005812703.1| gi|478468340|ref|YP_007743213.1| gi|478460238|ref|YP_007734306.1| gi|527326329|ref|YP_008352522.1| gi|478455716|ref|YP_007727906.1| gi|478456632|ref|YP_007727015.1| 272561.CT772 315277.CTA_0842 471472.CTL0141 471473.CTLon_0141 580049.JALI_7771 672161.CTB_7771 gi|166154114|ref|YP_001654232.1| gi|389858467|ref|YP_006360709.1| gi|478463843|ref|YP_007739655.1| gi|478473748|ref|YP_007735196.1| gi|385240316|ref|YP_005808158.1| gi|385246701|ref|YP_005815523.1| gi|478472847|ref|YP_007733414.1| gi|471328946|ref|YP_007540471.1| gi|527320497|ref|YP_008346697.1| gi|478474652|ref|YP_007730728.1| gi|385242168|ref|YP_005810008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]