SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453025|ref|YP_007720773.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453025|ref|YP_007720773.1|
Domain Number 1 Region: 267-568
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.22e-72
Family DNA repair protein MutS, domain III 0.0000121
Further Details:      
 
Domain Number 2 Region: 569-803
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-56
Family ABC transporter ATPase domain-like 0.00000171
Further Details:      
 
Domain Number 3 Region: 3-107
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.23e-34
Family DNA repair protein MutS, domain I 0.0001
Further Details:      
 
Domain Number 4 Region: 107-266
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 2.49e-32
Family DNA repair protein MutS, domain II 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478453025|ref|YP_007720773.1|
Sequence length 820
Comment DNA mismatch repair protein MutS [Chlamydia trachomatis L2b/Canada1]
Sequence
MTHKLTPMMQQWHQCKEQAGDCLLLFRLGEFYEAFFDDALILAQNLDITLTQRQNVPMSG
IPATCLDGYVDRLVSRGFKVAIAEQADNTEGSKGLVPRTINRLITPGALLSSSLLPEKAN
NYVLAINQVGSLYGLSCLDLSIGTFLVAEYDNTKDLIEAICRLAPTELLSHAKFYQKNAA
VIKQLQQHLRITLSEYVSWAFEYQSATKKLYTCFQVSSLDGFGLQGLVPAINAAGALLSY
IQDKLLLPISHLSIPKIYGQQKHLLIDKASQTNLELLSPIHGEHGKGSLLQVMERTSTPM
GGRLLRNTLINPFYDLKEITLRQDSVEFFLQQEDLRKILKRQLSCVRDLERLATKISTSL
ATPKDIGTLRDSLLSCTHIADNLQNCALPEFLENKFLIAPPLCSLIKTLSTELIQELPLK
VSEGNIFANHYHPDLLRLRNIKENSKSWILEYQERIRNETGIKKLKVCYAQALGYYIEVA
SNLAPQLPKEFIRRQSRLHAERFTTQELQQFQDEVFSVEDKLQTLETKLFKELCFYIVEH
RDLILKLSTAVADLDYVVSLAELAAEYDYRRPLVDHSDALSITKGMHPVALTLLDKGTFI
PNDTVMHSAQTRMILLTGPNMAGKSTYIRQIALLVIMAQMGSFIPARSAHIGIVDKIFTR
IGAGDNLSKGMSTFMVEMAETANILHNATDRSLVILDEIGRGTSTYDGLAIAQAVVEFLL
FTDGKKAKTLFATHYKELTELEMHCQHVENFHAMVKENSGQPIFMYEIVKGHSKKSFGIH
VAKLAGFPLSVVSRAQQILHQFEGPDLRPEPEKAQQLVMF
Download sequence
Identical sequences A0A0E9E1T9 B0B918 B0BAP7
gi|339625545|ref|YP_004717024.1| gi|478453939|ref|YP_007718101.1| gi|527326351|ref|YP_008352544.1| gi|482545257|ref|YP_007851175.1| gi|478471069|ref|YP_007729710.1| gi|527325424|ref|YP_008351618.1| WP_009873407.1.100883 WP_009873407.1.101735 WP_009873407.1.11148 WP_009873407.1.17082 WP_009873407.1.18643 WP_009873407.1.22210 WP_009873407.1.25195 WP_009873407.1.27753 WP_009873407.1.27980 WP_009873407.1.38794 WP_009873407.1.40464 WP_009873407.1.40808 WP_009873407.1.42718 WP_009873407.1.45552 WP_009873407.1.48923 WP_009873407.1.5416 WP_009873407.1.58046 WP_009873407.1.58308 WP_009873407.1.5967 WP_009873407.1.60427 WP_009873407.1.61004 WP_009873407.1.62489 WP_009873407.1.71307 WP_009873407.1.79775 WP_009873407.1.83642 WP_009873407.1.85365 WP_009873407.1.87079 WP_009873407.1.95142 WP_009873407.1.97423 WP_009873407.1.99598 YP_001654252.1.27483 gi|166155009|ref|YP_001653264.1| gi|527324292|ref|YP_008350488.1| gi|527327272|ref|YP_008353464.1| gi|482546199|ref|YP_007852115.1| gi|478454831|ref|YP_007717210.1| gi|166154134|ref|YP_001654252.1| gi|478468360|ref|YP_007743233.1| gi|478470169|ref|YP_007723449.1| gi|527320518|ref|YP_008346718.1| gi|478464761|ref|YP_007741453.1| gi|478450325|ref|YP_007719882.1| gi|478467460|ref|YP_007718992.1| gi|478447633|ref|YP_007716321.1| gi|527328198|ref|YP_008354389.1| gi|527329124|ref|YP_008355314.1| 471472.CTL0160 471473.CTLon_0161 gi|478451226|ref|YP_007721668.1| gi|478465661|ref|YP_007742343.1| gi|527318643|ref|YP_008344845.1| gi|478471960|ref|YP_007740563.1| gi|478453025|ref|YP_007720773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]