SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453026|ref|YP_007720774.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453026|ref|YP_007720774.1|
Domain Number 1 Region: 111-415
Classification Level Classification E-value
Superfamily DNA primase core 7.98e-82
Family DNA primase DnaG catalytic core 0.0000548
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.15e-35
Family DNA primase zinc finger 0.00023
Further Details:      
 
Weak hits

Sequence:  gi|478453026|ref|YP_007720774.1|
Domain Number - Region: 482-515
Classification Level Classification E-value
Superfamily N-terminal domain of DnaB helicase 0.0824
Family N-terminal domain of DnaB helicase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478453026|ref|YP_007720774.1|
Sequence length 595
Comment DNA primase [Chlamydia trachomatis L2b/Canada1]
Sequence
MYYTEESLETLKHSIDIVSVLGEYVHLKRSGADYKACCPFHDEKTPSFIVYPTRGHYHCY
GCGEHGDAINFLMKQQGYSFSEAVLFLAKKFHVDLVVRTRETSGQDSKDSLRRINREAER
FFQYCLLHLPEGEEALAYLYKRGFSPDTIDRFQIGYAPEQRLFIQAMEERNISVKQLEWA
GYLAKDWFLFAQRIMFPIQDALGYTIGFSSRRFKEGGRGGKYINSPETILFKKSRVLYGL
QFSRKRIAKERRVILVEGQADCLQMIDFGFNCTLAAQGTSFTETHVHELVKLGVSKAYLL
FDGDAAGEKASLRVGDLCQAAGITAIVCRLPSGQDPDSFLMQRGPEELRELLDRGEDYLS
FLVWHKIHSYEQFTPREKARVIEEVIQQVRCWGSPITIHEYLRQLASLVKVPEPAVLSYL
SSITSAAEDKGKKVSAKEPSSESEQTSTEGKISKKISPRMILEADVIRCLLFAKPEDEFV
PATVKQYLSPEEFHCAEYRAIFVMAMNHYNDRQTLPSMDEMMSLVVGTEAMTLLVARRMN
TELMRDIVVQSIQKLLDKHWRDRKRKLCHQTGKGLDSLQEYVRLSGERVKVSLVS
Download sequence
Identical sequences A0A0E9FYR0 A0A0H3MCL4
gi|482546201|ref|YP_007852117.1| gi|478467461|ref|YP_007718993.1| gi|478464762|ref|YP_007741454.1| WP_009873409.1.100883 WP_009873409.1.101735 WP_009873409.1.11148 WP_009873409.1.11732 WP_009873409.1.17082 WP_009873409.1.18643 WP_009873409.1.22210 WP_009873409.1.25195 WP_009873409.1.27753 WP_009873409.1.27980 WP_009873409.1.38181 WP_009873409.1.38794 WP_009873409.1.40464 WP_009873409.1.40808 WP_009873409.1.42718 WP_009873409.1.45552 WP_009873409.1.48923 WP_009873409.1.49465 WP_009873409.1.51159 WP_009873409.1.5416 WP_009873409.1.58046 WP_009873409.1.58308 WP_009873409.1.5967 WP_009873409.1.60427 WP_009873409.1.61004 WP_009873409.1.62489 WP_009873409.1.64162 WP_009873409.1.71307 WP_009873409.1.79775 WP_009873409.1.83642 WP_009873409.1.85365 WP_009873409.1.87079 WP_009873409.1.95142 WP_009873409.1.97423 WP_009873409.1.99598 YP_001654253.1.27483 gi|527329126|ref|YP_008355316.1| 471472.CTL0162 471473.CTLon_0163 gi|478453026|ref|YP_007720774.1| gi|527328200|ref|YP_008354391.1| gi|478452126|ref|YP_007715432.1| gi|166154135|ref|YP_001654253.1| gi|478454832|ref|YP_007717211.1| gi|339625546|ref|YP_004717025.1| gi|478468361|ref|YP_007743234.1| gi|478447634|ref|YP_007716322.1| gi|478451227|ref|YP_007721669.1| gi|478462966|ref|YP_007738787.1| gi|478471961|ref|YP_007740564.1| gi|527326353|ref|YP_008352546.1| gi|527324294|ref|YP_008350490.1| gi|166155010|ref|YP_001653265.1| gi|478471070|ref|YP_007729711.1| gi|478450326|ref|YP_007719883.1| gi|527327274|ref|YP_008353466.1| gi|478453940|ref|YP_007718102.1| gi|478465662|ref|YP_007742344.1| gi|527318645|ref|YP_008344847.1| gi|482545259|ref|YP_007851177.1| gi|527320520|ref|YP_008346720.1| gi|527325426|ref|YP_008351620.1| gi|478470170|ref|YP_007723450.1| gi|478463863|ref|YP_007739675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]