SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453032|ref|YP_007720780.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453032|ref|YP_007720780.1|
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 1.43e-40
Family Ribosomal protein L25-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478453032|ref|YP_007720780.1|
Sequence length 185
Comment 50S ribosomal protein L25/general stress protein Ctc [Chlamydia trachomatis L2b/Canada1]
Sequence
MELVVQSRETDKKSVIKKIRQQGGIPAVLYSGGKSLANIVVDARVFSKFLSTLESGALAS
TVFTLSYEGREIKALVKDIQYHVTTYDVIHLDFEELVDGRDVRLNVPIRCINTVDCVGVK
LGGSLRQVIRCIRVVCKPKDIVPFLELDVQSLGLSQTLKLSDICIPEGIRPVTSLKEVAV
TVARR
Download sequence
Identical sequences A0A0E9AY96 B0B926 B0BAQ5
WP_009873414.1.100883 WP_009873414.1.101735 WP_009873414.1.11148 WP_009873414.1.11732 WP_009873414.1.17082 WP_009873414.1.18643 WP_009873414.1.22210 WP_009873414.1.25195 WP_009873414.1.27753 WP_009873414.1.27980 WP_009873414.1.32801 WP_009873414.1.38181 WP_009873414.1.38794 WP_009873414.1.40464 WP_009873414.1.40808 WP_009873414.1.42718 WP_009873414.1.45552 WP_009873414.1.48923 WP_009873414.1.49465 WP_009873414.1.51159 WP_009873414.1.53299 WP_009873414.1.5416 WP_009873414.1.58046 WP_009873414.1.58308 WP_009873414.1.5967 WP_009873414.1.60427 WP_009873414.1.61004 WP_009873414.1.62489 WP_009873414.1.64162 WP_009873414.1.71307 WP_009873414.1.79775 WP_009873414.1.83642 WP_009873414.1.85365 WP_009873414.1.87079 WP_009873414.1.95142 WP_009873414.1.97423 WP_009873414.1.99598 YP_001654259.1.27483 gi|478470176|ref|YP_007723456.1| gi|527324300|ref|YP_008350496.1| gi|478468367|ref|YP_007743240.1| gi|478447640|ref|YP_007716328.1| gi|478450332|ref|YP_007719889.1| gi|478462972|ref|YP_007738793.1| gi|478463869|ref|YP_007739681.1| gi|478471076|ref|YP_007729717.1| gi|478453032|ref|YP_007720780.1| 471472.CTL0168 471473.CTLon_0169 gi|527329132|ref|YP_008355322.1| gi|482545265|ref|YP_007851183.1| gi|527327280|ref|YP_008353472.1| gi|478451233|ref|YP_007721675.1| gi|478452132|ref|YP_007715438.1| gi|478464768|ref|YP_007741460.1| gi|478471967|ref|YP_007740570.1| gi|482546207|ref|YP_007852123.1| gi|478453946|ref|YP_007718108.1| gi|478454838|ref|YP_007717217.1| gi|527318651|ref|YP_008344853.1| gi|478467467|ref|YP_007718999.1| gi|527326359|ref|YP_008352552.1| gi|166154141|ref|YP_001654259.1| gi|527325432|ref|YP_008351626.1| gi|527322415|ref|YP_008348613.1| gi|166155016|ref|YP_001653271.1| gi|527328206|ref|YP_008354397.1| gi|527320526|ref|YP_008346726.1| gi|478448533|ref|YP_007722567.1| gi|478465668|ref|YP_007742350.1| gi|339625553|ref|YP_004717032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]