SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453046|ref|YP_007720794.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453046|ref|YP_007720794.1|
Domain Number 1 Region: 4-316
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 3.17e-64
Family PlsX-like 0.00000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478453046|ref|YP_007720794.1|
Sequence length 321
Comment putative glycerol-3-phosphate acyltransferase PlsX [Chlamydia trachomatis L2b/Canada1]
Sequence
MKVRLGVDMMGGDHDPLVVWEALGEVLLSSTGEQPVEFTVFATSDVHHQLMNSPLSRSVR
IVTAEDFVSMEDSLLAAVRKKRSSMALGLDALQQGDLDGFVSSGNTAALVTLARSKIPMI
PAVPRPALLVSVPTLSGFAVILDVGATVSVNPDEMVGFARMGLAYRQSLSSNSNQPFTLG
LLNIGSEERKGTDSHKQTFRMLRNIFGSAFLGNIESGDVFSGKVDIVVTDGFTGNVFLKT
AEGLFDFLRHILGDRLEKSIKMQFDYTIYPGSIISGLSRLVIKCHGKSHGTALFGGISGA
IDLARANVCSRIADRFGDNVV
Download sequence
Identical sequences A0A0E9AYP4 B0B939 B0BAR8 O84817
gi|339625566|ref|YP_004717045.1| gi|478448547|ref|YP_007722581.1| gi|478458474|ref|YP_007731659.1| gi|478447654|ref|YP_007716342.1| gi|527320540|ref|YP_008346740.1| gi|478455755|ref|YP_007727945.1| gi|478450346|ref|YP_007719903.1| gi|478428948|ref|YP_007541388.1| gi|478467481|ref|YP_007719013.1| gi|385244896|ref|YP_005812740.1| gi|15605545|ref|NP_220331.1| gi|385244016|ref|YP_005811862.1| gi|386263168|ref|YP_005816447.1| gi|527329146|ref|YP_008355336.1| gi|478452146|ref|YP_007715452.1| gi|527319620|ref|YP_008345821.1| gi|389859383|ref|YP_006361624.1| gi|478471090|ref|YP_007729731.1| gi|471328986|ref|YP_007540511.1| gi|166154154|ref|YP_001654272.1| gi|385242213|ref|YP_005810053.1| gi|482546221|ref|YP_007852137.1| 272561.CT811 471472.CTL0182 471473.CTLon_0182 gi|478470190|ref|YP_007723470.1| gi|527327294|ref|YP_008353486.1| gi|478453960|ref|YP_007718122.1| gi|527321493|ref|YP_008347692.1| gi|527328220|ref|YP_008354411.1| gi|478460277|ref|YP_007734345.1| gi|478462078|ref|YP_007737028.1| gi|478457564|ref|YP_007726157.1| gi|478462986|ref|YP_007738807.1| gi|527318665|ref|YP_008344867.1| gi|527324314|ref|YP_008350510.1| gi|478465682|ref|YP_007742364.1| gi|478471981|ref|YP_007740584.1| gi|478454852|ref|YP_007717231.1| gi|478468381|ref|YP_007743254.1| gi|385241286|ref|YP_005809127.1| gi|478464782|ref|YP_007741474.1| gi|166155029|ref|YP_001653284.1| gi|527325446|ref|YP_008351640.1| gi|478473788|ref|YP_007735236.1| gi|478463883|ref|YP_007739695.1| NP_220331.1.57406 WP_009872947.1.100883 WP_009872947.1.101362 WP_009872947.1.101735 WP_009872947.1.102133 WP_009872947.1.11148 WP_009872947.1.11732 WP_009872947.1.13674 WP_009872947.1.13837 WP_009872947.1.15381 WP_009872947.1.17082 WP_009872947.1.18643 WP_009872947.1.1923 WP_009872947.1.19304 WP_009872947.1.20022 WP_009872947.1.22210 WP_009872947.1.25195 WP_009872947.1.25246 WP_009872947.1.27753 WP_009872947.1.27980 WP_009872947.1.28239 WP_009872947.1.29171 WP_009872947.1.30792 WP_009872947.1.31373 WP_009872947.1.32156 WP_009872947.1.32801 WP_009872947.1.34934 WP_009872947.1.36244 WP_009872947.1.36518 WP_009872947.1.3661 WP_009872947.1.37417 WP_009872947.1.37673 WP_009872947.1.38181 WP_009872947.1.38504 WP_009872947.1.38794 WP_009872947.1.39258 WP_009872947.1.40464 WP_009872947.1.40808 WP_009872947.1.4264 WP_009872947.1.42718 WP_009872947.1.44223 WP_009872947.1.45552 WP_009872947.1.48551 WP_009872947.1.48923 WP_009872947.1.49465 WP_009872947.1.51159 WP_009872947.1.51530 WP_009872947.1.53299 WP_009872947.1.5416 WP_009872947.1.55117 WP_009872947.1.57533 WP_009872947.1.58046 WP_009872947.1.58308 WP_009872947.1.5967 WP_009872947.1.60427 WP_009872947.1.61004 WP_009872947.1.62489 WP_009872947.1.62510 WP_009872947.1.64162 WP_009872947.1.67104 WP_009872947.1.67250 WP_009872947.1.69355 WP_009872947.1.69519 WP_009872947.1.69991 WP_009872947.1.71307 WP_009872947.1.71619 WP_009872947.1.74323 WP_009872947.1.75470 WP_009872947.1.77651 WP_009872947.1.78375 WP_009872947.1.79775 WP_009872947.1.83642 WP_009872947.1.85256 WP_009872947.1.85365 WP_009872947.1.86066 WP_009872947.1.87079 WP_009872947.1.87298 WP_009872947.1.87666 WP_009872947.1.88177 WP_009872947.1.9107 WP_009872947.1.93216 WP_009872947.1.95142 WP_009872947.1.97423 WP_009872947.1.99598 YP_001654272.1.27483 gi|527326373|ref|YP_008352566.1| gi|527322429|ref|YP_008348627.1| gi|478456670|ref|YP_007727053.1| gi|478453046|ref|YP_007720794.1| gi|385245823|ref|YP_005814646.1| gi|478451247|ref|YP_007721689.1| gi|482545279|ref|YP_007851197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]