SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453051|ref|YP_007720799.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453051|ref|YP_007720799.1|
Domain Number 1 Region: 6-172
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-47
Family Phosphoglucomutase, first 3 domains 0.00059
Further Details:      
 
Domain Number 2 Region: 264-371
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.85e-31
Family Phosphoglucomutase, first 3 domains 0.0021
Further Details:      
 
Domain Number 3 Region: 162-263
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-29
Family Phosphoglucomutase, first 3 domains 0.0011
Further Details:      
 
Domain Number 4 Region: 365-453
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.57e-19
Family Phosphoglucomutase, C-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478453051|ref|YP_007720799.1|
Sequence length 458
Comment phosphoglucosamine mutase [Chlamydia trachomatis L2b/Canada1]
Sequence
MTRDVSQLFGTDGVRGRANFEPMTVETSVLLGKAIAGVLLEKHAGKHRVVVGKDTRLSGY
MFENALIAGLTSMGIETLMLGPIPTPGVAFITRAYRADAGIMISASHNPYRDNGIKIFSS
DGFKIGQAVEERIEAMVASKDFGKLPDDHAVGKNKRVKDATGRYIEYAKATFPKGRTLKG
LRIVLDCAHGATYRVAPSVFEELDAEVICYGCEPSGCNINAGCGALWPSTIQKAVIEHKA
DVGIALDGDGDRLIMVDEKGHIVDGDMLLSICASDLKRRQALPDNRVVATVMTNFGVLRY
LESLGIQVTISPVGDRHVLQHMLENQAVLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMI
ESESTLSDLTACIVKSPQALINVPVTKKVPLESLANVQGVLKEVKEVLGDSGRILLRYSG
TENICRVMVEGTKKHQVDSLAKTIVDVVEAEIGAGISE
Download sequence
Identical sequences A0A0E9FY16 B0B944 B0BAS3
gi|527326380|ref|YP_008352573.1| gi|478464787|ref|YP_007741479.1| gi|478447659|ref|YP_007716347.1| gi|478452151|ref|YP_007715457.1| gi|478468386|ref|YP_007743259.1| gi|478462991|ref|YP_007738812.1| gi|166155034|ref|YP_001653289.1| 471472.CTL0187 471473.CTLon_0187 gi|166154159|ref|YP_001654277.1| gi|527328227|ref|YP_008354418.1| WP_009873427.1.100883 WP_009873427.1.101735 WP_009873427.1.11148 WP_009873427.1.11732 WP_009873427.1.17082 WP_009873427.1.18643 WP_009873427.1.22210 WP_009873427.1.25195 WP_009873427.1.27753 WP_009873427.1.27980 WP_009873427.1.32801 WP_009873427.1.38794 WP_009873427.1.40464 WP_009873427.1.40808 WP_009873427.1.42718 WP_009873427.1.45552 WP_009873427.1.48923 WP_009873427.1.49465 WP_009873427.1.51159 WP_009873427.1.53299 WP_009873427.1.5416 WP_009873427.1.58046 WP_009873427.1.58308 WP_009873427.1.5967 WP_009873427.1.60427 WP_009873427.1.61004 WP_009873427.1.62489 WP_009873427.1.64162 WP_009873427.1.71307 WP_009873427.1.79775 WP_009873427.1.83642 WP_009873427.1.85365 WP_009873427.1.87079 WP_009873427.1.95142 WP_009873427.1.97423 WP_009873427.1.99598 YP_001654277.1.27483 gi|482545286|ref|YP_007851204.1| gi|478470195|ref|YP_007723475.1| gi|482546228|ref|YP_007852144.1| gi|527327300|ref|YP_008353492.1| gi|527325453|ref|YP_008351647.1| gi|527320547|ref|YP_008346747.1| gi|478453965|ref|YP_007718127.1| gi|478463888|ref|YP_007739700.1| gi|527329153|ref|YP_008355343.1| gi|527324321|ref|YP_008350517.1| gi|339625572|ref|YP_004717051.1| gi|478467486|ref|YP_007719018.1| gi|478448552|ref|YP_007722586.1| gi|478453051|ref|YP_007720799.1| gi|478471986|ref|YP_007740589.1| gi|478450351|ref|YP_007719908.1| gi|527318672|ref|YP_008344874.1| gi|527322435|ref|YP_008348633.1| gi|478451252|ref|YP_007721694.1| gi|478471095|ref|YP_007729736.1| gi|478454857|ref|YP_007717236.1| gi|478465687|ref|YP_007742369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]