SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453087|ref|YP_007720835.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478453087|ref|YP_007720835.1|
Domain Number - Region: 45-139
Classification Level Classification E-value
Superfamily GroEL apical domain-like 0.0118
Family GroEL-like chaperone, apical domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478453087|ref|YP_007720835.1|
Sequence length 168
Comment hypothetical protein L2BCAN1_00906 [Chlamydia trachomatis L2b/Canada1]
Sequence
MWHKEPMYAVLQLAETPPVTGTTNSATADEIITRFAKDSNPLIVTVYYIYQSVLVAQNNL
SLVAEQLQANAAAQTFLNNEEALYQYTTIPKNQVNSQNSSYLQNVQSVNQAVGASRQAIQ
NQISGLGNASQVISSNLNTNNNIIQQSLQVGQALIQTFSQIVSLIANI
Download sequence
Identical sequences A0A0E9AS06 A0A0H3MGG4
gi|478463921|ref|YP_007739733.1| gi|166155067|ref|YP_001653322.1| gi|527322471|ref|YP_008348669.1| gi|527318707|ref|YP_008344909.1| 471472.CTL0220 471473.CTLon_0220 gi|478448585|ref|YP_007722619.1| gi|527325489|ref|YP_008351683.1| gi|478454890|ref|YP_007717269.1| gi|478453087|ref|YP_007720835.1| gi|478452184|ref|YP_007715490.1| gi|478468419|ref|YP_007743292.1| gi|478467519|ref|YP_007719051.1| gi|478470228|ref|YP_007723508.1| gi|478447692|ref|YP_007716380.1| gi|482546263|ref|YP_007852179.1| gi|482545321|ref|YP_007851239.1| gi|166154192|ref|YP_001654310.1| gi|527329189|ref|YP_008355379.1| gi|527324356|ref|YP_008350552.1| gi|478450384|ref|YP_007719941.1| gi|478463024|ref|YP_007738845.1| gi|478472019|ref|YP_007740622.1| gi|527327336|ref|YP_008353528.1| gi|527328263|ref|YP_008354454.1| gi|478465720|ref|YP_007742402.1| gi|527326416|ref|YP_008352609.1| WP_009873456.1.100883 WP_009873456.1.101735 WP_009873456.1.11148 WP_009873456.1.11732 WP_009873456.1.17082 WP_009873456.1.18643 WP_009873456.1.22210 WP_009873456.1.25195 WP_009873456.1.27753 WP_009873456.1.27980 WP_009873456.1.32801 WP_009873456.1.38181 WP_009873456.1.38794 WP_009873456.1.40464 WP_009873456.1.40808 WP_009873456.1.42718 WP_009873456.1.45552 WP_009873456.1.48923 WP_009873456.1.49465 WP_009873456.1.51159 WP_009873456.1.53299 WP_009873456.1.5416 WP_009873456.1.58046 WP_009873456.1.58308 WP_009873456.1.5967 WP_009873456.1.60427 WP_009873456.1.61004 WP_009873456.1.62489 WP_009873456.1.64162 WP_009873456.1.71307 WP_009873456.1.79775 WP_009873456.1.83642 WP_009873456.1.85365 WP_009873456.1.87079 WP_009873456.1.95142 WP_009873456.1.97423 WP_009873456.1.99598 YP_001654310.1.27483 gi|478451285|ref|YP_007721727.1| gi|527320583|ref|YP_008346783.1| gi|478453999|ref|YP_007718161.1| gi|478471128|ref|YP_007729769.1| gi|478464820|ref|YP_007741512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]