SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|478453090|ref|YP_007720838.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|478453090|ref|YP_007720838.1|
Domain Number - Region: 48-86
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.000628
Family Multidrug efflux transporter AcrB transmembrane domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478453090|ref|YP_007720838.1|
Sequence length 88
Comment hypothetical protein L2BCAN1_00909 [Chlamydia trachomatis L2b/Canada1]
Sequence
MGFGTVRGKGKAVKSFFLRPLQNLEVGLFSLPIVLLLGEIGCVSSISSVSLVAVLSIVGV
FVALVSFFRSWGYGLSVVGAIFFGLALX
Download sequence
Identical sequences gi|478453090|ref|YP_007720838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]