SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478453110|ref|YP_007720858.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478453110|ref|YP_007720858.1|
Domain Number 1 Region: 238-612
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.33e-101
Family Amylase, catalytic domain 0.00000000195
Further Details:      
 
Domain Number 2 Region: 112-217
Classification Level Classification E-value
Superfamily E set domains 1.1e-28
Family E-set domains of sugar-utilizing enzymes 0.00019
Further Details:      
 
Domain Number 3 Region: 615-700
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000018
Family alpha-Amylases, C-terminal beta-sheet domain 0.028
Further Details:      
 
Domain Number 4 Region: 16-108
Classification Level Classification E-value
Superfamily E set domains 0.000000000373
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478453110|ref|YP_007720858.1|
Sequence length 738
Comment glycogen branching enzyme [Chlamydia trachomatis L2b/Canada1]
Sequence
MDPFFLNTQHVELLVSGKQSSPQDLLGIVSESLNQDRIVLFRPGAETVFVELRGKIQQAE
SHHSGIFSLPVMKGISPQDYRVYHQNGLLAHDPYAFPLLWGEIDSFLFHEGTHQRIYERM
GAIPCEIDGVPGVRFIVWAPHAQRVSVIGDFNGWHGLVNPLHKVSDQGVWELFVPGLTAG
ACYKWEMVTESGQVLIKSDPYGKFFGPPPRSVSVVIDDSYEWNDSEWLEERIKKTEGPMN
IYEVHVGSWQWQEGQPLNYKELADQLALYCKQMHYTHVELLPVTEHPLNESWGYQTTGYY
APTSRYGSFEDLQYFIDTMHQHGIGVILDWVPGHFPIDSFAMSGFDGTPLYEYTRNPSPL
HPHWHTYTFDYAKPEVCNFLLGSALFWIDKMHVDGIRVDAVSSMLYLDYGRYAGEWVPNR
YGGRENLDAIRFLQQFNTVIHEKYPGVLTFAEESTTFPKITVSVEEGGLGFDYKWNMGWM
HDTLHYFEKDFPYRPYHQSDLTFPQWYAFSERFLLPFSHDEVVHGKRSLIGKMPGDAWRQ
FAQLRLLLGYQICQPGKKLLFMGGEFGQGREWSPGRELDWELLDISYHQGVHLCSQELNA
LYVQSPQLWQADHLPSSFRWVDFSDVRNGVVAYLRFADADAKKALLCVHHFGVGYFPHYL
LPILPLESCDLLMNTDDTRFGGSGKGFREPEILTPEIARQEREAAGLIEADDESGPDCWG
LDIELPPSATLIFSVTLQ
Download sequence
Identical sequences A0A0E9AZI2 B0BAX7
WP_012263574.1.101735 WP_012263574.1.11732 WP_012263574.1.18643 WP_012263574.1.25195 WP_012263574.1.27753 WP_012263574.1.38181 WP_012263574.1.38794 WP_012263574.1.40464 WP_012263574.1.42718 WP_012263574.1.45552 WP_012263574.1.48923 WP_012263574.1.53299 WP_012263574.1.5416 WP_012263574.1.58308 WP_012263574.1.5967 WP_012263574.1.79775 WP_012263574.1.97423 gi|478467541|ref|YP_007719073.1| gi|478464842|ref|YP_007741534.1| gi|478472041|ref|YP_007740644.1| gi|478470250|ref|YP_007723530.1| gi|166155087|ref|YP_001653342.1| gi|478448606|ref|YP_007722640.1| gi|478454021|ref|YP_007718183.1| gi|478471150|ref|YP_007729791.1| gi|478454912|ref|YP_007717291.1| gi|478453110|ref|YP_007720858.1| gi|478465742|ref|YP_007742424.1| gi|478450406|ref|YP_007719963.1| 471473.CTLon_0241 gi|478468441|ref|YP_007743314.1| gi|478451307|ref|YP_007721749.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]