SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452338|ref|YP_007720086.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452338|ref|YP_007720086.1|
Domain Number 1 Region: 288-323,389-463
Classification Level Classification E-value
Superfamily TPR-like 0.000000128
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Weak hits

Sequence:  gi|478452338|ref|YP_007720086.1|
Domain Number - Region: 82-137
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 0.0432
Family Nucleoplasmin-like core domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452338|ref|YP_007720086.1|
Sequence length 492
Comment hypothetical protein L2BCAN1_00117 [Chlamydia trachomatis L2b/Canada1]
Sequence
MCLRHWMCFIGIGSLLLPTALRATERMRKEPIPLLDKQQSFWNVDPYCLESICACFVAHR
DPLSAKRLMYLFPQLSEEDVSVFARCILSSKRPEYLFSKSEEELFAKLILPRVSLGVHRD
DDLARVLVLAEPSAEEQKARYYSLYLDVLALRAYVERERLASAAHGDPERIDLATIEAIN
TILFQEEGWRYPSKQEMFESRFSELAAVTDSKFGVCLGTVVLYQAVAQRLDLSLDPVTPP
GHIYLRYKDKVNIETTSGGRHLPTERYCECIKESQLKVRSQMELIGLTFMNRGAFFLQKG
EFLQASLAYEQAQSYLSDEQISDLLGITYVLLGKKAAGEALLKKSAEKTRRGSSIYDYFQ
GYISPEILGVLFADSGVTYQETLEYRKKLVMLSKKYPKSGSLRLRLATTALELGLVKEGV
QLLEESVKDAPEDLSLRLQFCKILCNRHDYVRAKYHFDQAQALLIKEGLFSEKTSYTLLK
TIGKKLSLVAPS
Download sequence
Identical sequences A0A0E9FV25
gi|478469482|ref|YP_007722762.1| gi|478466773|ref|YP_007718305.1| gi|478462277|ref|YP_007738098.1| gi|478452338|ref|YP_007720086.1| gi|478471273|ref|YP_007739876.1| gi|478454144|ref|YP_007716523.1| gi|478470382|ref|YP_007729023.1| gi|478449638|ref|YP_007719195.1| gi|478453251|ref|YP_007717413.1| gi|478464974|ref|YP_007741656.1| gi|478464074|ref|YP_007740766.1| gi|478467673|ref|YP_007742546.1| gi|478450538|ref|YP_007720980.1| gi|478451438|ref|YP_007714744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]