SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478452658|ref|YP_007720406.1| from Chlamydia trachomatis L2b/Canada1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478452658|ref|YP_007720406.1|
Domain Number 1 Region: 20-136,168-491
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.52e-140
Family GABA-aminotransferase-like 0.000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|478452658|ref|YP_007720406.1|
Sequence length 497
Comment serine hydroxymethyltransferase [Chlamydia trachomatis L2b/Canada1]
Sequence
MASLLDRYLRNISDKSQQNLASVAYLASLDHLLHAFPSIGQSIVQELKSQRSRLKMIASE
NFSSLSVQLAMGNLLTDKYCEGSPFKRFYSCCENVDAIEWECAETAKELFGAESAFVQPH
SGADANLLAIMSIITQKIQSPAVQQLGYKTINDLPEQEYEALKAEMAQHKCLGPSLNSGG
HLTHGTVRMNIMSKLMHCLPYEVNLDTELFDYDEIAKIAKEHKPTVLIAGYSSYSRRFNF
ATLKQIAEDCGAVLWVDMAHFAGLVAGGVFVGEENPMPYADIVTTTTHKTLRGPRGGLVL
AKKEYANTLNKACPLMMGGPLPHVIAAKAIALKEAMTINFRKYAHKVVENAQTLAEVFQR
NGLRLLTGGTDNHMLIIDLTSLGVPGRIAEDMLTSVGIAVNRNTIPSDASGQWKTSGIRL
GTPALTTLGMGSAEMEEVANIIVKVLRNITVRSNAESGSSKSEGELSEGIAQEARQRVAD
LLGRFPLYPEIDLETLV
Download sequence
Identical sequences A0A0E9AUH3 B0B804 B0BC69
gi|527326885|ref|YP_008353077.1| gi|478471593|ref|YP_007740196.1| gi|339626109|ref|YP_004717588.1| gi|527323905|ref|YP_008350101.1| gi|478448160|ref|YP_007722194.1| gi|482546745|ref|YP_007852661.1| gi|478454464|ref|YP_007716843.1| WP_009873807.1.100883 WP_009873807.1.101735 WP_009873807.1.11148 WP_009873807.1.11732 WP_009873807.1.17082 WP_009873807.1.18643 WP_009873807.1.22210 WP_009873807.1.25195 WP_009873807.1.27753 WP_009873807.1.32801 WP_009873807.1.38181 WP_009873807.1.38794 WP_009873807.1.40464 WP_009873807.1.40808 WP_009873807.1.42718 WP_009873807.1.45552 WP_009873807.1.48923 WP_009873807.1.49465 WP_009873807.1.51159 WP_009873807.1.53299 WP_009873807.1.5416 WP_009873807.1.58046 WP_009873807.1.58308 WP_009873807.1.5967 WP_009873807.1.60427 WP_009873807.1.62489 WP_009873807.1.64162 WP_009873807.1.71307 WP_009873807.1.79775 WP_009873807.1.83642 WP_009873807.1.85365 WP_009873807.1.97423 WP_009873807.1.99598 YP_001654763.1.27483 gi|478452658|ref|YP_007720406.1| gi|478467093|ref|YP_007718625.1| gi|478470702|ref|YP_007729343.1| gi|478450859|ref|YP_007721301.1| gi|166155520|ref|YP_001653775.1| gi|482545801|ref|YP_007851719.1| gi|478449958|ref|YP_007719515.1| gi|166154645|ref|YP_001654763.1| gi|478447268|ref|YP_007715956.1| gi|527322001|ref|YP_008348199.1| gi|478453572|ref|YP_007717734.1| gi|478451759|ref|YP_007715065.1| gi|478469803|ref|YP_007723083.1| gi|478465294|ref|YP_007741976.1| gi|478463497|ref|YP_007739309.1| gi|527318255|ref|YP_008344457.1| gi|478467994|ref|YP_007742867.1| gi|478462598|ref|YP_007738419.1| gi|527327812|ref|YP_008354003.1| 471472.CTL0691 471473.CTLon_0687 gi|478464394|ref|YP_007741086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]