SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MESCA000897-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA000897-PA
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-17
Family C-terminal domain of adrenodoxin reductase-like 0.00013
Further Details:      
 
Weak hits

Sequence:  MESCA000897-PA
Domain Number - Region: 117-212
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0104
Family C-terminal domain of adrenodoxin reductase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA000897-PA
Sequence length 272
Comment pep:novel scaffold:Msca1:scaffold50079:202:1093:1 gene:MESCA000897 transcript:MESCA000897-RA description:""
Sequence
STDITEYSLEALTTSSIKRVQLVGRRGPLQAAFTIKELREMLKLPNVTTSWRKEDFVGVE
DVVGTLPRPRKRLTELMLTSLKAQTTIDTKERQFIPIFLRSPEVISYNSVDFVVNKMDGD
KAIRTNDMENLPADLILRSIGYKSSCVDSKIPFDTKSGKVFNRDGRVQVSGEKDVIERGL
YAAGWLGTGPTGVILTTMNGAFGVAKNIVDDFNSNLIEAGENKPGLDTRQLRAVTWDKWE
KIDKAEIEAGKPKGKPREKIVDIEKMLEIAGV
Download sequence
Identical sequences T1GC91
MESCA000897-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]