SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MESCA005961-PA from Megaselia scalaris 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MESCA005961-PA
Domain Number 1 Region: 34-151
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.45e-25
Family C-terminal domain of adrenodoxin reductase-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 19-61,157-216
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000134
Family C-terminal domain of adrenodoxin reductase-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MESCA005961-PA
Sequence length 220
Comment pep:novel scaffold:Msca1:scaffold31171:8119:8778:-1 gene:MESCA005961 transcript:MESCA005961-RA description:""
Sequence
NPIFKGLDESHGFFTSKSFLPKVADGSKPGLCACKASQALPQLHGNVIVLGAGDTAFDCA
TSALRCGAKKVFVVFRKGSSGIRAVPEEVELAREEGCEFIPYMSPQKVIVKDGRIAAMEF
CRTEQDEDGNWVEDDEQTTKLKANFVISAFGSGLYQTDVLEAIKPVELDSWHLPKVDSKT
QQTSLPNVFCGGDLAGNADTTVESVNDGKTAAWHMHCYLQ
Download sequence
Identical sequences T1GQQ0
MESCA005961-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]