SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449066362|ref|YP_007433444.1| from Sulfolobus acidocaldarius N8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449066362|ref|YP_007433444.1|
Domain Number 1 Region: 213-362
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 0.0000000000000561
Family Hypothetical protein aq 1666 0.0024
Further Details:      
 
Domain Number 2 Region: 15-111
Classification Level Classification E-value
Superfamily LigT-like 0.0000034
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449066362|ref|YP_007433444.1|
Sequence length 380
Comment hypothetical protein SacN8_01575 [Sulfolobus acidocaldarius N8]
Sequence
MYLIEIRPVLEKHRLKQFLRKFRFHLHNTHKIPHITLIYSFKPKPLVKISEISQIISDVA
GKYEDLRFLFDGISIKRGSKGLVLAFNISPSMELVALQRELYQRLKPLIKIERGKEKFSE
SLWFHAAISFGTTEKELKEIEKTDKFERLKQFLYPGVALRICLLGNSKIVAEYDTATKSL
LVRKQALSKRYLSKTFKAYREKFLKVNIDNMSMRENIWFVADTHFGHKNIIKYCSRPFIE
VKEMDDFIIRRWNEVVSPNDTVYILGDFSINHKKLKEYTSLLRGNKVFIQGNHDVPGVGP
ESMYFNFAGYDFLLTHKPSPQGNVWNIHGHVHNNRLREFPFVNGELKTINVGVDVTKFYP
VNLSWIIDHIERKETKLWLS
Download sequence
Identical sequences A0A0U3H3W5 M1IST9 M1IZU6 Q4JBU2
330779.Saci_0321 gi|449068638|ref|YP_007435719.1| gi|449066362|ref|YP_007433444.1| gi|70606160|ref|YP_255030.1| WP_011277239.1.100797 WP_011277239.1.13097 WP_011277239.1.15291 WP_011277239.1.18585 WP_011277239.1.18739 WP_011277239.1.19907 WP_011277239.1.20267 WP_011277239.1.24072 WP_011277239.1.28054 WP_011277239.1.29213 WP_011277239.1.30898 WP_011277239.1.31299 WP_011277239.1.3283 WP_011277239.1.33024 WP_011277239.1.33782 WP_011277239.1.34459 WP_011277239.1.34536 WP_011277239.1.35781 WP_011277239.1.35800 WP_011277239.1.36276 WP_011277239.1.37881 WP_011277239.1.38112 WP_011277239.1.38253 WP_011277239.1.39308 WP_011277239.1.39398 WP_011277239.1.43265 WP_011277239.1.4394 WP_011277239.1.45682 WP_011277239.1.48356 WP_011277239.1.49892 WP_011277239.1.50721 WP_011277239.1.51246 WP_011277239.1.5150 WP_011277239.1.53520 WP_011277239.1.55288 WP_011277239.1.55517 WP_011277239.1.56706 WP_011277239.1.57256 WP_011277239.1.64117 WP_011277239.1.64360 WP_011277239.1.67449 WP_011277239.1.68798 WP_011277239.1.7301 WP_011277239.1.74875 WP_011277239.1.78046 WP_011277239.1.78998 WP_011277239.1.8042 WP_011277239.1.83345 WP_011277239.1.87279 WP_011277239.1.90653 WP_011277239.1.90680 WP_011277239.1.95134 WP_011277239.1.96274 WP_011277239.1.97501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]