SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000014066 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000014066
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.96e-28
Family Nitrogenase iron protein-like 0.022
Further Details:      
 
Domain Number 2 Region: 235-317
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000824
Family DRTGG domain 0.089
Further Details:      
 
Weak hits

Sequence:  EPrPR00000014066
Domain Number - Region: 526-579
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00981
Family Pan module (APPLE domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000014066
Sequence length 1057
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_71:16450:22317:1 gene:maker-par_contig_71-fgenesh-gene-0.3 transcript:EPrPRT00000014066 description:"Cobyrinic acid a,c-diamide synthase family protein."
Sequence
MKKRAVYVAATRQHVGKTSTCIGILHGLTSRIDNIGFLKPVGQESVLVENSSMRVDKDVA
VAKEIFHLAKCHYADMSPVVIPPGYTRKFLDGEITLESQLRKIRQSFERITALNDYTIVE
GTGHTGVGSIVDVNNARVAAELGIDMILIANGGIGSAFDDLALNYSLCREYGVRVRGVIL
NKVRPDKLEMVREYFPKALEKWDIPLIGVVPNLSTSLVTSGLRRFLVKLSSNEYNDTLFV
THASRNDIILGYLSHGQNYEARTGEKFNGGLILTGVPPVDQPQPYIMDIIKSANLPVLYA
PVTTFEAMEKITRFTAKFNPTDRQKVLRCGEHYAQYIDFDVVLDRVPPHLVSLSPSLLMT
VSPLKTLLLASATVAAVSTRGAQGCDKLWNGICFTYAANDDVFWGSDCDFSAADIGSARG
GADKCGGFCKSSDTCERWSWTNDQGGTCYLKSKSPWTLVAAKGVQCGFRKSLRSSTTLLP
LSFSMTVSPFQTLLLACATVATVSTRGALGCDKLLNGICFTYSVGDDAFWGLDCDFSAAD
IGSTHSGPERCGMLCKNRPSCERWSWNDYQGGTCYLKGRSPWTLVAAKGVSCGFRNAPHK
FLSSSSMASLLLASAALARRISSSHVLPPRTLGAAVAAASPFGSIFPPSTLSPTDARGIA
TSRVLAKRLGGHSAFVVKSSKFRKKSMKKKDKLKRDTAPHKTHVESMRALKERGRENERN
EQLWEQLEGDDELNKELDNKPLPPLEEIRQDPLEYDEDGREIDLTRPFKQVTSMENWNYD
GVQDDDDDEEEEYDGQEYDSDEAMEAASRQGDLTAEERQQIEAIRAQDALALTEDPSVDD
PLTLRAMDLSDFGRFQTENISRAEQLLDEFVKGPHADELSVVTLTSMLSVYANALRLGRA
EHFFQEAFPKHSVEPNVHTFRVLMQMYTRARRTPKAEALFEEYKQKVEDGTMAADAITVG
MLVDHYARHRFLRKALVLLEQADDMGALPLAERHYKKVRRLTEKFGLFTELIPEDPYAVI
TAGTRHKLLEKRKVRAEVIAFNKKTGRKFLLPASVKQ
Download sequence
Identical sequences EPrPR00000014066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]