SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000014286 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000014286
Domain Number 1 Region: 10-105
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000000593
Family Barwin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000014286
Sequence length 585
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_91:9120:10877:1 gene:maker-par_contig_91-fgenesh-gene-0.1 transcript:EPrPRT00000014286 description:"Conserved gene of unknown function."
Sequence
VTQYAIQTPDIGSCRLKGIDSDSDNFKFYASVSAKDVDDMNAGCARCIKVTKDGSTTSVT
AYVLDVCQGCKAGELKLSAAALTTLAIDPNLNNATATYRFSNCPASFQSGSSVKACLMEG
ASNTYIPLQFFNSLKPIASANISGVAAKQQKDSFFFSGTPQVSNANGNTQWFKDVKVTLT
SNDGESQSGTFAFGGTSGCATSTFQFSAASTADGKDDDGAGGAAGGSKSGSSGVVIGAIA
GGVGALIIVIGSIIFIRRRRANQEFEDARHDDPAQQYLSPTTKPRAPQSPERPTYADNSM
HNSTDDPSDHDGPESPTVDFDDAGTPVAPARNMNGAGRSDPFSAPAPVPVPPPQQQYQPQ
YQPQYEDQKQQRAAAAAAAPKVAHQTYVTPQQFSYSKPVETQRAPNNTSFRSNSSGVGAR
AAPTFPAPVLPKSHTQSDDDERRSSFDVDDQRETEELKSRERFSSLLSDDNAVAPHSSES
AYATGHVTSPQSYVRATTLRRASSKAPERTPFRFTAQSEPESSLGSSGYSDRDSYADNHQ
HANANANPNASNPSSGYSRESLGILGYPYARKPSGRSSVTGTNRV
Download sequence
Identical sequences EPrPR00000014286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]