SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000018777 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000018777
Domain Number 1 Region: 157-409
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 2.64e-32
Family ATP-dependent DNA ligase catalytic domain 0.0027
Further Details:      
 
Domain Number 2 Region: 416-452,488-597
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.59e-24
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00082
Further Details:      
 
Domain Number 3 Region: 877-991
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000183
Family DNA topoisomerase II binding protein 1, TopBP1 0.069
Further Details:      
 
Domain Number 4 Region: 670-773
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000471
Family BRCT domain 0.081
Further Details:      
 
Weak hits

Sequence:  EPrPR00000018777
Domain Number - Region: 73-186
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000144
Family ATP-dependent DNA ligase DNA-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000018777
Sequence length 993
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_822:4374:7650:-1 gene:maker-par_contig_822-snap-gene-0.8 transcript:EPrPRT00000018777 description:"DNA ligase."
Sequence
SLSFGALCRVLEAVERTPKSDAKLALLDRERTYNLKEKKIAKVYIDVLGMASESRDAQKL
EHFNDPTIVQSKSVGDFAAVLYDVLQYRSLVGNQKFQHTVGVVNTLLDELVRAEDAAHKR
RVFMKLATEFPANEQKWIIRMMLKDLKIGLRHERVLTFIHPDASEMYNHTNDLHKVCVDL
RNSSIRYVPKIEPFQVFSPMLAKRVNFGECTTAINADVFVMEPKLDGERITCHVQGDAVQ
FISRNGVNYTDLYGPFVKPYIQSQLLPGLDVILDGEMMVWDNLEYKLREFGLLKNVANAL
RAGEQTHRWLCYVVYNGPGEVNAVMGLPFHARRKLLVKILKPLDHRVVIIEQTLVNSKSP
KERHDLVMAEVDKQVSNGGEGVILKDVNSHYMCGESSRKTKKWIKLKPDYAGMTTNLDVV
IIGGFYGTGRRRSGNVSVFLLGVLAHSLDDDAAQEAIKPGAPIPTIYTXXXXDDDAAQEA
MKPGAPIPTIYTFAKVGTGYNLEELEAMRRDLEPHWKPWDNDNIPAHFNGWKPQKSDLKP
DVWIDPRHSKVLEVYGFELTFSTLYQTGLTIRFPRCKAIRNDKPWYQCMSVQDLNAIRGS
IFNKRAADVTLGQRKATKRITKKTAIRRGTGGVIAEYSQAKLEGIDVQHHIFDGLEFCAK
LEGIDVQHHIFDGLEFCVLPGKYETDHLQMDTIPDDMLPKDERRNITKQSIEKLLHACGA
TIVQNPIADSTSYVVAASDAGFKVANLKKQGKFNMVYLHWLVSCVASARLLSLKARDFIF
ATEATSVLLAKEYDRYGDHFTDPVSADELKMIFREAGRVVDTPAKSTPWQAQLDVLAVEE
EDAMESAFTCLAHCVSTPWQARLDALAVEEEDAMESAFTCLAHCVVYVDQYHSVHTATST
VSNDEIDAFGPMKLLEQQIRLYGGRISDVVDHQVTHIVVASRDDRARIEMLQPIIRAMRR
TSQKEPPVVTKEWVEQCVRHETQLPVDGFFLPV
Download sequence
Identical sequences EPrPR00000018777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]