SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000021479 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EPrPR00000021479
Domain Number - Region: 92-146
Classification Level Classification E-value
Superfamily YbiA-like 0.051
Family YbiA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000021479
Sequence length 277
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_1701:1652:2585:-1 gene:maker-par_contig_1701-snap-gene-0.1 transcript:EPrPRT00000021479 description:"Conserved gene of unknown function."
Sequence
MRVIAPALECLHIRRDHGLRLLQRLWPNTASAITRTRPPRPLPFDYPPPGREVPAGDSSH
RFQFVVQPLVKKTVGQREANGRMLDNFAVNGATFEEIIRKIWDEFSCEVKGRADWRKFTQ
FKQNRYIVDTTKSDRAWNQWLSSVRDEVIRLVIYEYGSAIVRTTDQTAFLDSCVLPVHTD
RAGAVAEVDLFAVIDALQQRWQSTYCAPPAAWRMWASAITSDLNRTTWGRRVADAPPVNV
VPHLQPPNSRLEQHLVSVARSGHFGLQCIEGLVVELR
Download sequence
Identical sequences EPrPR00000021479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]