SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000022998 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000022998
Domain Number 1 Region: 751-889
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 6.28e-18
Family Barwin 0.027
Further Details:      
 
Weak hits

Sequence:  EPrPR00000022998
Domain Number - Region: 564-649
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 0.0638
Family PurM N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000022998
Sequence length 996
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_2547:213:4060:-1 gene:maker-par_contig_2547-fgenesh-gene-0.0 transcript:EPrPRT00000022998 description:"Carbohydrate-binding protein."
Sequence
MPEKELFFAANADPAGLAPQSVDGTGDPSLRNGELPATDSATQESLATGETTSETAAAAA
IARVVPVRLPASELEKDVVEKLIGELFFNGHEEDGVTREHALELFVRKADSPNYEIVIKN
QRLYDLAIKFVANGASYRLASRLVYCVREETKLAHYGGCTDVRVANYVRAVLASNLQRLA
WMLRAAWTYCIATETVVHQRTAYLDVRVRLWHNSGLRDFHLFAVPQVDAVAPPRVIERLG
AVLDILDPRWRSKLPGSRGATPGAHLYEELVAVVQLLEVVAKNAVTAFADQTFYDELVAV
VQMVRRAPVDETALPNKHELSSLPAAHASPRGFVQTVLTALRWPLRSRAPVSNLLASPTR
DAQDRELSGMSNTHGHDMGVSFDGSHTSVHDHVLELGKLTLVLKDVVGATRDFVDFHQST
PLHEPGAAVVTQGSFILSLANAEQFLQNEGGSVAIEMLDLVTHALERTQLARSVAAFAVD
LLASVAAVAHEGRHYCAESAQIVVTPPRVMPYDVYHMGKDAFLALVASQFERLRETFTPQ
EIRKIQNEYFFFLAAVETEPILSGVLKTHGRDTDVSFAWSCLNSRFLFLQEFVGGLASVV
PDAMSGTLHAELLYLNWEKPDYQLTSVDFALEGILHARQKMQIEVVDVNHLRAALRNSSL
ASGGVQDDPRRPAVAIDTATPAGGSVLDSLASAEEVDDPMDGGHAENDVDASGTAAESAT
DSPDAEESKLNTSAFNMSSSVSRVVPPLLLCVAWAPLVLAGESFTGRATTYGLTNAIGGS
CSVRLAPQGLDPTLFVAMNGDQYAKSSACSRCLSIKGPKGTVTTFVADVCFECGHGNLDL
NTALWNTIVGGDPRIEPITWQYTPCPDEKEKLCMKEGSNAQWLALQVANSRDGVKAMEIG
GVKAEVIGITSFYQVSGGINLDLSKLDVRLTSTSGITSKLTLDSAKSFVGCAMPSNDDNK
QSNGGGGTATVTVDVTGVTKDLNAWRSYRRRHSHVY
Download sequence
Identical sequences EPrPR00000022998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]