SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPR00000023422 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000023422
Domain Number 1 Region: 14-146
Classification Level Classification E-value
Superfamily TPR-like 9.49e-24
Family Tetratricopeptide repeat (TPR) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000023422
Sequence length 199
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_2849:2725:3520:1 gene:maker-par_contig_2849-snap-gene-0.5 transcript:EPrPRT00000023422 description:"Mitochondrial Protein Translocase (MPT) Family."
Sequence
MVTVVYSGGTINDRYFSDGRYLDAIDCYTTALKLCPAEDEYAYNRALCPAEDEYAYNRAV
YFSNRAACLSKIGRTEEAIEDCSQAIELSPTYALLRRAELYEKDDKLDDALKDYNAVLAI
DPTIRTAVTGHTRVKKVVDERTEKMKAEMLDKLKGFGNTILGKFGMSTDNFQVVQDPQSG
SYNINFVQNPSPAGSGNQQ
Download sequence
Identical sequences EPrPR00000023422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]