SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000024536 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000024536
Domain Number 1 Region: 103-352
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 2.22e-60
Family ATP-dependent DNA ligase DNA-binding domain 0.0000137
Further Details:      
 
Domain Number 2 Region: 612-758
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.68e-47
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0000051
Further Details:      
 
Domain Number 3 Region: 380-604
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.53e-46
Family ATP-dependent DNA ligase catalytic domain 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000024536
Sequence length 774
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_4030:25:2419:1 gene:maker-par_contig_4030-snap-gene-0.1 transcript:EPrPRT00000024536 description:"DNA ligase."
Sequence
EAPKEETKAPKEEKPEKKKQSAPAGEPEQEEAEEEEEEAFVPEEAEEEDEDEEDVDMEEE
EDEEEKATAKKKNTPRKQTPTKAAADAKKSVANTDTAVAPLEDDVESIPYTALAALFSKI
EISSSRLVIQDLLSNFFRQVIRKAPQDLLACIYLCVCTDLAPPFENLKIGIGDAILMKAI
GEATGTNPKFIKDMYQKEGDLGKVAQNARSKQNTLSFATLMPAAKTQVLSVPEIFNQFVK
IAKMTGNNSQQQKCSIIKGLLVKCEKDKKASSSSASPKSEQTAEAAKYIIRGLQGKLRIG
LAEKSILMGLTYAFMLEKDAKDKEKQEKALAFVKKAFAECPSYNALVKAFQDVQTQVETT
PFLKVEDFAKVADACVLTPGTPVSPMLARPTKAYAMVFDRFQGQPFTCEYKYDGERAQIH
ILPTGEIAIFSRNFENSTERFPDVKLMIAKAAKKAQITSCIVDAEVVAVDKATNTRLPFQ
VLSTRSRKNVKVEDIKVPVCIYAFDLLFLNGESLLKEPLGKRREILKTQFEIEDGSFELA
TSLDVDGVMPGTDDAEAMEIAVDKVRTFLEEAVKENCEGLMVKTLEKDATYEPANRSHKW
LKLKKDYLDGIGDSTDLVPIGAFHGRGKRTGVYGAYLLACYDPETEMYQPITKLGTGLND
EQLKEFHAQLKEKVTDKPHQDYAITDAIKPDVWFEPSVVWEILGADLSISPKYTAAMGHV
AKDKGISLRFPRFIRIRDDKNTTQATSSSQIADLYRAQGLATVTGEEDEDDMLI
Download sequence
Identical sequences EPrPR00000024536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]