SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000025306 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000025306
Domain Number 1 Region: 51-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.88e-16
Family Nitrogenase iron protein-like 0.048
Further Details:      
 
Domain Number 2 Region: 252-384
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.000000000000033
Family DRTGG domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000025306
Sequence length 418
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_5279:21:1274:-1 gene:maker-par_contig_5279-snap-gene-0.1 transcript:EPrPRT00000025306 description:"Phosphate acetyltransferase."
Sequence
MWRLRGSLRRVAAYSLPKRPLSTAASAGGAKTPVDSLYVTSTDLIRKASPVLLGLSHILE
QKFSSVGYFRPIAPSPGAAVQDHHLELFKSELELTQSNEELYGVTSDRALKSWLDGKEDD
LVEEILTKYETVKQQHDFVIIEGTQITQHDTSLSWKINVDIAKAIGSPVLLVTDLGPVAL
SDDDLAHEIVSRSLLGKDQVEDEGLNYVGTIPNRVRAHDPTALHFKLRSMFAKENLPFLG
YLPLDHLIASKRLNEVAHKLGAKQLFGARNIANNVIVSEAIVATSYLKDLFAHMKEHDDG
LLVITSADRSDVMLGLLASRIPGVLPAVAGIVLTNGDYPYSNTKEILEGVSVLDKTGLSI
PIFSVAGDTFQTANTLSRISTDILPTSLRKIQQCRNLFDLHIEKEMLVGELDEGVVVN
Download sequence
Identical sequences EPrPR00000025306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]