SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000013454 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000013454
Domain Number 1 Region: 36-511
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.15e-175
Family GABA-aminotransferase-like 0.000000000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000013454
Sequence length 520
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_19:14282:16024:1 gene:fgenesh_masked-par_contig_19-abinit-gene-0.48 transcript:EPrPRT00000013454 description:"Serine hydroxymethyltransferase."
Sequence
MRAALLSTCRRRAASATAVPRALQTARMITSESREWSTALNKPLVETDPELFDIIEREKQ
RQRNCISLIASENFTSTAVLDALGSVMSNKYSEGYPGARSLAHRSGVNSYYGGNKFIDEA
ENLCRARALEAFNLDPELWGVNVQSLSGSPANFQVYTALLQPHDRIMALDLPHGGHLSHG
YQLGNKKISATSIYFESMPYRLNEATGIIDYDKLEETAALFRPKLIVAGTSAYSRNIDYK
RMREVCDQQNAILLADMAHISGLVAAGVVPSPFEYADVVTTTTHKSLRGPRGAMIFYRKG
LKSVDKKGVETHYDLQQRIDFAVFPGLQGGPHNHTISALATALHQAQSPSFVAYQKQVLQ
NARALAGELMNLGYEVVSNGTDNHLALVNVKASRGVDGARVETLLENANMVVNKNTVPSD
KSALVPSGIRLGAPALTTRGCTEDDFVQVARFIDDGVKLAAELNAECIAKGGKKVKDFKE
YIVTDASAVARVEALKAKVTAFVREFPTIGFEVADMKYKD
Download sequence
Identical sequences EPrPR00000013454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]