SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000016368 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000016368
Domain Number 1 Region: 15-80
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000136
Family Barwin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000016368
Sequence length 477
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_350:4495:5948:-1 gene:maker-par_contig_350-snap-gene-0.11 transcript:EPrPRT00000016368 description:"Carbohydrate-binding protein."
Sequence
MRRQQERQRVDAACRLCWGTTTAAEKGTVVYIVEDQRPRWYADPQPSTSDLNLSPQAFQN
LTDASVGRVPVRWRFIGCPSFDEGGETPVSSPVTPPDPIGCAICIHGNSSAYWLALQPVN
DTLGVSTLRVNGQRVTRVKDSLNYLFDIGDRNGRIRLTQLEISITTRSRRRFSRLVAVKP
GSCVTLRRSDEQHSGAGDGGSTGNPTNWPTTPVDDGGGDEEGDATENDGNDNEIMDDLST
PNNGEFVVTRTDPPFPVNIPTISPPVVPIVPAVVSPMTISPALTPSMTSDPRLPSFTFRP
PTGPTSPPVASIFVAPPAPSTLVPMFSPPPPPPPPPAAAAAAPQSPPAIQTFPSLTPPPI
DKAGGRPTPRPADTGIFGSSSGVFSKSPPLKPTSEPCGSPPPSSPSSSPPMPTIGRTPVA
QFSGGVLTSPLFVGLLLGTVGLVGAVVAYRAKTNQRQRLALVPPASGAVLRTDFTSL
Download sequence
Identical sequences EPrPR00000016368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]