SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000018121 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000018121
Domain Number 1 Region: 128-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.21e-66
Family GABA-aminotransferase-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000018121
Sequence length 545
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_665:3242:5030:1 gene:maker-par_contig_665-fgenesh-gene-0.1 transcript:EPrPRT00000018121 description:"Serine palmitoyltransferase."
Sequence
MSEWWATIGQPVAEALLSLDRHKIREALATFPHNYYEYIKGIYERSPEHVIVETFLIVFV
VYITFFKKDKPSKAAVKFTAKEIDELVDDWEPEPIIPKSYKVELDKTQPYGVVENRPDTH
MKLQGIDAPVLNLATFDFLGLGSRQELKDVAIQTLTKYGCGSCGPRGFYGTIDVHEILEQ
DLAQMMGTVDSITFSDSESTSSSVLPAFAKRGDLVVLDDGCNDSILVGVDLARCTVHYYK
HNDMEDLERVLSGIRAADKKAGRGSDCQRRYIVTEAVFRNHGDMIDLPKVVALAKAHYFR
LFLDESYSFGVLGANGRGITEHFGVPLSDVSIVCGSLATAAAGVGGFSTGAREVVDYQRL
NSAGYVFSASAPPFTSACTSEAIRIMRTEPQLFVKLRENAFLVHDVLAAGVKGVFSVSND
RCSPVVHLRLLPELLAGLTSDAAKREVQRMVCDDVMTNLLSRGIAVCSPRYKTGQTLEPL
PSVRVSVTAIHDSKELKDACSVIAKECVRVAKSALKAIPHKAEYANGHSNGVSSGMSLRQ
RKAKN
Download sequence
Identical sequences EPrPR00000018121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]