SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000019213 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000019213
Domain Number 1 Region: 27-185
Classification Level Classification E-value
Superfamily E set domains 1.96e-35
Family RhoGDI-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000019213
Sequence length 414
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_929:979:2658:-1 gene:maker-par_contig_929-snap-gene-0.6 transcript:EPrPRT00000019213 description:"Centriole proteome protein."
Sequence
MSRTRYTPEDVLELEAPTESFLCPLSANTYGIEFLHFAIADYDSKRKIFEIGKDRPGKAV
PKVDLTQARGESAYRTIRYEFSEDVLRLPAVSTSLEFSVGPKEVRALRMIERHYFRDEIV
KSFDFTFGFCIPNSVNTWEAVYAMPPLEDDLINDMIAHPYATVSDSFYFVGDELIMHNKA
EYKYVVEDRAQSKRSYYNDDDEEDAKAPAKSSRAESKGSKSNGSTAKWSKEDDYDNNDNN
RKSSGFGQPNSGSKVEVRTLKSEREEDPHRLAQRQKQIDYGKNTLGYDHYCAMVPRNKRR
KGEHPMTPDKTLNVSKKHFDSMVRRWRQALHDYDPPELAEQLRVAEQQAAIAPAQEAATT
STSMNDVADLDPELADLDPSKQPSTTAAPSIFDAFDEDEGAAVDCEDDDDDDLL
Download sequence
Identical sequences EPrPR00000019213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]