SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000020821 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000020821
Domain Number 1 Region: 69-158,190-238,269-488,521-544
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.13e-49
Family Cystathionine synthase-like 0.00032
Further Details:      
 
Domain Number 2 Region: 801-1023
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.22e-41
Family PP-loop ATPase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000020821
Sequence length 1075
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_1445:1496:4743:-1 gene:maker-par_contig_1445-snap-gene-0.5 transcript:EPrPRT00000020821 description:"ATPase of the PP-loop superfamily."
Sequence
AKSAGANGAPGSSERFFCEELEEDLGETIETATTDEQRATERAQMVQYVADNLVGRHETF
DSPFGDRALCYADFTASGKSLKCVEDYIQRDVLPLYGNTHTTTSITGIQSTCFRHEARQI
IAQAVNAKITGRGAEDSVLFTGQGSTSAVQKLVTALGLHVPLADPSQRPVVFVGPFEHHS
NLXXXXADPSQRPVVFVGPFEHHSNLLPWRESVAQVVVIPENDHGHVDIGVLTKKLRQYA
SRPLKIGAFSAASNLTGILTDLRQYASRPLKIGAFSAASNLTGVLTDADAVTATLHQHGA
LAFWDYASCAPYVQIDMNPMVANEQMRPFVYKDAVYFSGHKFIGGPGSPGVLVVKKRLLG
NPVPTTPGGGTVFFVTERDHRYLSNREEREEGGTPDVIGSIRLGLAFEIKQRIGTQHIME
RERQHVTRVRSSFASNDKLVLLGQQKDTEQLPVFSFLIRCGDRFLHYNFVCALLNDLFGI
QTRGGCQCAGPYATRLMGMEKQHVLALESALIEKKEMLRPGFSRMSLPYFMEDEEVEYIL
EAIHFIADEGWKLLPQYKFNHKSGAWKHTSRFTRFPNRKWLSHFSMNLDGASKPEQMNPR
RVADIKQHRLDNLAVARQLAKESGVKASGSVAASATQMLDDAYEALRWFIYPAEAAEALK
KGTSPKLTAVIMGPYQPQRYLEGTLKHQWETPEEDKMDTVNVQQSTTQKRVCESGACCPV
PVETSVSSTREVGGKYPLRSTGSRSVSMTNGSSPVNGAASDAIATLSRAQEITAQMNEKT
AAVKLFPTPGKKLMRWVGQGLMQWNMIEEGDRLLLGVSGGKDSLSLLHILLTVQKRAPVK
FYLACATVDPQTASFDPSPMKAYMASLGVEYHYLSENIIERAACEMQGDSICAYCSRMKR
GLLYSCCRKHKFNKLVLAQHLDDLAESFFMSAMHNGQLRTMKAKYWNDEKDVEILRPLAY
VREYELKKFAYDSRLPVINENCPACFEEPKERHRVKKMLAQEESLNPDMYNSIRRAILPL
MDDSVYEPLNAIRLRVEKSKQSRPKAPSNKTRKSAPEPVEAAVGGQDVSTAATDQ
Download sequence
Identical sequences EPrPR00000020821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]