SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000021751 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000021751
Domain Number 1 Region: 238-567
Classification Level Classification E-value
Superfamily SIS domain 1.48e-65
Family double-SIS domain 0.00000576
Further Details:      
 
Domain Number 2 Region: 2-211
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.15e-51
Family Class II glutamine amidotransferases 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000021751
Sequence length 568
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_1821:2881:4818:-1 gene:snap_masked-par_contig_1821-abinit-gene-0.3 transcript:EPrPRT00000021751 description:"Glucosamine-fructose-6-phosphate aminotransferase"
Sequence
MNRGYDSAGMATMQLSEQPGASSEITTTKFASVSGTADSIHLLRASKDAHAGNTVGIAHT
RWATHGGKTDANSHPHSDMHGRVAVIHNGTFTNYNEIKQELLGEGVVFNSQTDTEVAAQL
IGHLMGEGADVLTATRIALSRLEGTWGLCVMARDEPDKIVIARNGSPLCIGYGANEMYVA
SETTAFSRYTKRFVSLKDGEVAVIKADSAELNPVDEKEGFLQRFPTSRLATAPDVKAEKE
RMLKVKHLMISACGTSLFASKYGAKLMRSLHAFDSVSTEDASECASDRLPRKDGGLLVVS
QSGETLDVTRVLKTVEELSVDVPTFSVVNSVGSLIARTTKCGVYLNAGRENAVASTKAFV
TQVTVMGLIAAWFAQNRDEGNRTKKDELIQAMHRLPIAIGMALRTRDQCAQVAESLQRSQ
HLFVLGKGFGEPIAYEGALKIKEITYLHAEGYAGGALKHGPFALIENEQDGQFGATPIIL
IVLDDEHAAFMKTAVEEVRARGAHTIVITDRPSLVQDIADTVIQIPSNGPMTALLASVPL
QLIAYELAVKKGINPDVPRNLAKAVTVD
Download sequence
Identical sequences EPrPR00000021751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]