SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000021843 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000021843
Domain Number 1 Region: 40-475
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.1e-120
Family Pyridoxal-dependent decarboxylase 0.00000000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000021843
Sequence length 519
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_1864:450:2068:1 gene:maker-par_contig_1864-fgenesh-gene-0.0 transcript:EPrPRT00000021843 description:"Glutamate decarboxylase."
Sequence
MQVSSTKPSLRNNVEPTNGHGLRRYPSTIASGPDYSAEEQSDSEPIYGHPLMCASVPTER
FPRRSVPARVAHQLIKDELSLDGNPKMNLASFVSTYMEPEAEDLMVEGLRKNYIDLDQYP
QTAEIHNRCVQMLANLYHAPLGVGEQATGTGCIGSSEAIMLAGLAMKRKWRDRRKAQGLP
YDSPNMVFGSNVQVCWHKMCKYFEIEIREADVSPDCLVLTAERARPLLDENTIGVSAILG
STFNGEYEDVAAIHAMVDEVNAANGWAIPIHVDAASGGFIAPFLNPELAWDFRLPNVKSI
NVSGHKFGLVYAGMGWALWRERQDLPDDLVFHVNYLGGDQHSFTLNFSKGAGNVVAQYYN
ILRFGFDGYRTIMEASMENAEYLRSSLLATGYFHIVDKQHMPLVAFALNDSSRYTCFDIQ
DKLKSRGWIVPAYTCSRGAESLVIMRVVVKQNFSYSMANMLVQDILKAIDALEKHHVLVE
TALSSPKATINKMHFKDVVHAIQANLKHQQSGITTHGVC
Download sequence
Identical sequences EPrPR00000021843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]