SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000022978 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000022978
Domain Number 1 Region: 195-346
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 7.12e-43
Family Eukaryotic ODC-like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-214
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.45e-42
Family Alanine racemase-like, N-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000022978
Sequence length 349
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_2533:791:1979:1 gene:maker-par_contig_2533-fgenesh-gene-0.0 transcript:EPrPRT00000022978 description:"Diaminopimelate decarboxylase."
Sequence
MDCSSSAELHIAHQLGVPGDQVIFTSNFTSKSDLATAAAQGVILNLDDVSLVDSVVAVHG
KCPELISFRLNPGLGRTDSETKSNVLGGPDAKFGVAPFQIVEAYRRAQAAGATRFGIHMM
TGSCVMNQLYWKETVTVLFDTIVALRKELGIEFEFMNIGGGLGIPYQPDQPVVDIEAISA
MLRGIFDDAMKTHGLTSIPRLCMENGRYMTGPYGWLVTRCEHIKESYGRYYGVDACMAHL
MRPGMYGAYHHITVPTREASGDREKAHVVGTLCENNDWFAKDRDLPRAFVGDLFVIHDTG
AHAHSMGFQYNGKLRAPEVLIRPNGEHSLIRKRETYDALYGNCVMPTDL
Download sequence
Identical sequences EPrPR00000022978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]