SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPR00000024514 from Pythium arrhenomanes ATCC 12531 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPR00000024514
Domain Number 1 Region: 34-170
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 4.53e-23
Family Pollen allergen PHL P 1 N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPR00000024514
Sequence length 433
Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_4003:1059:2360:1 gene:maker-par_contig_4003-fgenesh-gene-0.0 transcript:EPrPRT00000024514 description:"Carbohydrate-binding protein."
Sequence
MPTACLQIAMVPLVLVIVLLGESLATAQSSTPAGYFSGEGTQYTLSYPTDGNCNFMSFPE
EAKTKYAALNKPQFKTTTNCGRCALVSCVDPTKCADAKQQSEIVHIVDQCPECVRGDLDL
SPKVFESITGLQSDRVKIQWKFVDCPVRGKIQYCLKDGSNPFWTAIQPTNFLVGVKSLQV
NGQDTTMVDSAYYFLKDGKSASQTDLTALKVTLTSVNGEVLEETISLAGGGCVESKFQFS
KDRAADSEADFNDQTQTENRDAGSVTQNTQSPTPAPSPSPVVTTPMPTTTTPPTPTTPTP
TRTPTQPSAPSLRGSNEAAVIVPTPETTSPAPPTTSAVPTNEAGVVRQVTTRSGDGAQPT
SPVLIILLVLACTCLFVLGVLALRVKYRRRLKRESQAAKRSIIHVSDLPRLIVKQSSYEE
LASPTQRADIAFL
Download sequence
Identical sequences EPrPR00000024514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]