SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433641789|ref|YP_007287548.1| from Mycobacterium canettii CIPT 140070008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433641789|ref|YP_007287548.1|
Domain Number 1 Region: 213-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.07e-58
Family B3/B4 domain of PheRS, PheT 0.0000196
Further Details:      
 
Domain Number 2 Region: 480-596,626-725
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.04e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0061
Further Details:      
 
Domain Number 3 Region: 49-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.51e-32
Family Myf domain 0.0039
Further Details:      
 
Domain Number 4 Region: 735-830
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.18e-26
Family Anticodon-binding domain of PheRS 0.0004
Further Details:      
 
Domain Number 5 Region: 416-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000032
Family Domains B1 and B5 of PheRS-beta, PheT 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433641789|ref|YP_007287548.1|
Sequence length 831
Comment Phenylalanine tRNA synthetase, beta subunit [Mycobacterium canettii CIPT 140070008]
Sequence
MRLPYSWLREVVAVGASGWDVTPGELEQTLLRIGHEVEEVIPLGPVDGPVTVGRVADIEE
LTGYKKPIRACAVDIGDQQYREIICGATNFAVGDLVVVALPGATLPGGFTISARKAYGRN
SDGMICSAAELNLGADHSGILVLPPGAAEPGADGAGVLGLDDVVFHLAITPDRGYCMSVR
GLARELACAYDLDFVDPTSNSRVPPLPIEGPAWPLTVQPETGVRRFALRPVTGIDPAAVS
PWWLQRRLLLCGIRATCPAVDVTNYVMLELGHPMHAHDRNRISGTLGVRFARPGETAVTL
DGIERKLDIADVLIVDDAATAAIGGVMGAASTEVRADSTDVLLEAAVWDPAAVSRTQRRL
HLPSEAARRYERTVDPAISVAALDRCARLLADIAGGEVSPTLTDWRGDPPCDDWSPPPIR
MGVDVPDRIAGVAYPQGTTARRLAQIGAVVTHDGDTLTVTPPSWRPDLRQPADLVEEVLR
LEGLEVIPSVLPPAPAGRGLTARQQRRRAIGRSLALSGYVEILPTPFLPAGVFDLWGLEA
DDSRRMTTRVLNPLEADRPQLATTLLPALLEALVRNVSRGLVDTALFAVAQVVQPTEQTR
GVGLIPVDRRPTDDEIAMLDASLPRQPQHVAAVLAGLREPRGPWGPGRPVEAADAFEAVR
IIARASRVDVTLRPAQYLPWHPGRCAQVFVGESSVGHAGQLHPAVIERSGLPKGTCAVEL
NLDAIPCSAPLPAPRVSPYPAVFQDVSLVVAADIPAQAVADAVRAGAGDLLEDIALFDVF
TGPQIGEHRKSLTFALRFRAPDRTLTEDDASAARDAAVQSAAERVGAVLRG
Download sequence
Identical sequences gi|433641789|ref|YP_007287548.1| WP_015303129.1.13667 WP_015303129.1.73315 WP_015303129.1.80669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]