SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512650189|ref|YP_008108223.1| from Enterobacter sp. R4-368

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512650189|ref|YP_008108223.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.65e-110
Family FMN-linked oxidoreductases 0.000000000055
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.83e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000001
Further Details:      
 
Domain Number 3 Region: 461-519,558-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.16e-23
Family C-terminal domain of adrenodoxin reductase-like 0.000000938
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512650189|ref|YP_008108223.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Enterobacter sp. R4-368]
Sequence
MSHYPSLFTPLDLGFTTLKNRVLMGSMHTGLEERPDGAERLAAFYAERARHGVALIVTGG
VAPALSGVTMEGGAVLNDTSQLPHHRQITEAVHQEGGKIALQILHTGRYSYQPQLVAPSA
LQAPINRFTPHELSHDEILTLIDDFARCAALAQQAGYDGVEVMGSEGYLINEFLAARTNH
REDEWGGDYTRRMRFAVEVVRAVRERVGSDFIIIYRLSMLDLVEGGGTLEETIALAQAVE
AAGATLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGKVKVPLITTNRINDPGVADEI
LARGDADMVSMARPFLADAGFVSKAQNGRADEINTCIGCNQACLDQIFAGKVTSCLVNPR
ACHETLMPVLPAVQKKNLAVVGAGPAGLAFAINAAARGHGVTLFDAQAEIGGQFNVAKQI
PGKEEFYETLRYYRRMIDLTGVTLCLNQRVDPATLLGFDEVILASGIEPRMPPIDGIDHP
KVLNYLDVLRDKAPVGESVAIIGCGGIGFDTAMYLSQPGEPTSQNIAEFCVEWGIDTSLN
EVGGLRPEGPQLPKSPRRIVMLQRKASKPGEGLGKTTGWIHRATLLSRGVKMIPAVSYQK
IDDAGLHLLIGGEPQLLAVDHVVVCAGQEPKRELAEPLREAGKTVHLIGGCDVALELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences R9VQZ0
gi|512650189|ref|YP_008108223.1| WP_020455368.1.27976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]