SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512650942|ref|YP_008109011.1| from Enterobacter sp. R4-368

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512650942|ref|YP_008109011.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.96e-40
Family Frataxin-like 0.000000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512650942|ref|YP_008109011.1|
Sequence length 106
Comment hypothetical protein H650_16175 [Enterobacter sp. R4-368]
Sequence
MNDSEFHRLADGLWLTIEERLDDWDGDSDIDCEINGGVLTISFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWVCDRSGETFWDLLEQAASQQAGETVSFR
Download sequence
Identical sequences A0A059XJR7 A0A140IGQ5 A0A1C4E3T3 R9VSZ2
gi|512650942|ref|YP_008109011.1| WP_017459730.1.22877 WP_017459730.1.27976 WP_017459730.1.39022 WP_017459730.1.49916 WP_017459730.1.50109 WP_017459730.1.77694 WP_017459730.1.93752 WP_017459730.1.97016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]