SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|512652347|ref|YP_008110449.1| from Enterobacter sp. R4-368

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512652347|ref|YP_008110449.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 4.32e-30
Family YccV-like 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512652347|ref|YP_008110449.1|
Sequence length 105
Comment heat shock protein HspQ [Enterobacter sp. R4-368]
Sequence
MIASKFGIGQQVRHSLLGYLGVVVDIDPEYSLDEPSADELAVNDELRALPWYHVVMEDDD
GQPVHTYLAEAQLTSEITDEHPEQPSMDELARTIRRQLQAPRLRN
Download sequence
Identical sequences R9VWK2 W6IZY5
gi|512652347|ref|YP_008110449.1| WP_017456235.1.22877 WP_017456235.1.27976 WP_017456235.1.44590 WP_017456235.1.49916 WP_017456235.1.77694 WP_017456235.1.93752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]