SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512649587|ref|YP_008107555.1| from Enterobacter sp. R4-368

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512649587|ref|YP_008107555.1|
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-57
Family G proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 399-493
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.59e-25
Family EF-G/eEF-2 domains III and V 0.011
Further Details:      
 
Domain Number 3 Region: 292-370
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.73e-18
Family EF-G/eEF-2 domains III and V 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512649587|ref|YP_008107555.1|
Sequence length 599
Comment elongation factor 4 [Enterobacter sp. R4-368]
Sequence
MKNIRNFSIIAHIDHGKSTLSDRIIQICGGLSDREMEAQVLDSMDLERERGITIKAQSVT
LDYKANNGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAI
EMDLEVVPVLNKIDLPAADPERVAEEIEDIVGIDATDAVRCSAKTGVGVPDVLERLVRDI
PPPEGDPEAPLQALIIDSWFDNYLGVVSLVRIKNGTMRKGDKIKVMSTGQVYNADRLGIF
TPKQVDRTELKCGEVGWLVCAIKDILGAPVGDTLTSSRNPADKALPGFKKVKPQVYAGLF
PVSSDDYENFRDALGKLSLNDASLFYEPESSTALGFGFRCGFLGLLHMEIIQERLEREYD
LDLITTAPTVVYEVQTTNKEVVYVDSPSKLPPLNNIDELREPIAECHMLLPQEYLGNVIT
LCVEKRGVQTNMVYHGNQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYNFKRFQASNM
VRVDVLINGERVDALALITHNDNAPYRGRELVEKMKELIPRQQFDIAIQAAIGNHIIARS
TVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMKQVGNVELPQEAFLAILHVGKDSK
Download sequence
Identical sequences R9VNY7
WP_020454749.1.27976 WP_020454749.1.77694 gi|512649587|ref|YP_008107555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]