SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN00059-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN00059-PA
Domain Number 1 Region: 601-696
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 3.67e-30
Family Insect phospholipase A2 0.00066
Further Details:      
 
Domain Number 2 Region: 102-331
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-18
Family Eukaryotic proteases 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN00059-PA
Sequence length 710
Sequence
MASVTVFVFLLDNLPGFENILNTTLQKTAEASNFDVTLSDCDPFYEDIVWTDISKNNVVN
TDGEVRYGDAHDGEHGHYVQDMRVHRDATGSEIGVHKSKNTFLVSIFETVLNITAQTCGG
SLLSPRWVITAATCVDLLSHLYKKNLNLFQTHYSVIANANDPLTDGSVHNVTEISLNPIS
NEIPRIDNTSSFHSIKIPSVALLKIEPPVEGIFMDIVLEKISSGIEVVVFGWILNKDPTS
GQDTLNLATFKAITLESNVCKAYYSFVDESSLICLSPRGENEFNIRMMSSGGPVVLSLGN
KILMVAIAQLDSHTNLAAYLLHSHYSWIKETDESVVSPEPRAASRQCRVERPRDGRCMMS
FRRLLSAVRSARDALTRGAPMADGLFKSLVSLVVILCIAVSSPQSASAKPFAFSFPASWS
LAGLVGGVGARSEDHRREPAGVKPYTERRVSNDTLRMIYFHDQTVAVVELGLDKLLLNCE
LIETYDEDDTSRLLRQLSSINRPLAINFPQMTKLMSQCQQDDTSRLLRQLSSINRPLAIN
FPQMTKLMSQCQQVDGVEGSEGWAASRRRADWRERGAARLRAGGQHAGLLGGSPLSLLQG
IIPGTKWCGTGDIAADYHDLGSDRPLDRCCRTHDLCPSKVRAFSTRYNLTNNSLYSKSHC
TCDDMLFECLKATNTSASHLMGHIYFNIVQVPCFEDLPSGRRFREAKQGF
Download sequence
Identical sequences DPGLEAN00059-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]