SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN12657-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN12657-PA
Domain Number 1 Region: 1106-1228
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-32
Family Single strand DNA-binding domain, SSB 0.0001
Further Details:      
 
Domain Number 2 Region: 1233-1260,1385-1454
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-18
Family Single strand DNA-binding domain, SSB 0.0045
Further Details:      
 
Domain Number 3 Region: 965-1101
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.44e-17
Family BRCA2 helical domain 0.001
Further Details:      
 
Domain Number 4 Region: 1468-1584
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000223
Family Single strand DNA-binding domain, SSB 0.022
Further Details:      
 
Domain Number 5 Region: 1260-1371
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.000000000497
Family BRCA2 tower domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN12657-PA
Sequence length 1758
Sequence
MTIKNSDLLNQDVRKNITLSSHKKCGFIPLASIQAETSMNTENNFDSQCSMDTQLIDFVR
NAEAMMQEENDREKNKLKSPRDVASEKERIVLMDNTKQYMPKQHKVLNITEERQCGGKIN
DKCCEVGNKEDSDDITDLHNKSNSGDKLEAPTSPILSSSRSTSKPLVCMLEEFDNFEKLA
VPVLRKFTDFNEAKRAIHTQVKAKNFAIQSHSESVKYDRDKGIQNVLGVTRNAVDQADDC
MQVSDDIRTQYSFDVKVTNEDKMLFDSDDEIDVLPLTCALETYDEPGLLDKTLYVGFQTA
SNRSIQILADSFNKARCIFDDVSRKVADKSVTELVQDIDRKCTDGCHSTVDIKDKYRLNN
LRDTSDNPRGIVEEFCKKEDIIEIVDKKSVACGTAHNNAEYIDEQLIKEFDVSVVCDSDI
LDNKKISSDTQNSDKMCIESELKNDENDVINISSEEHNIAHTESSSTKCRGLLIENRETK
VNNFVGFRTASDKKIAVSDEAVIKTRNIFDNIDDLELSGCRSTTECIETKSVEKFPKNKP
NLHDSKNTEVTKDVFRNNKSIDTERFRGFRTASNKNVYISKSALEKSKKIFEDIGGNEDG
FRTDDTKKHDEDMERNKMFNKIAPSDNGYKTQTTMQGFITASKKPVTISEEALSRCKKIF
HDISYGDGIQNTSYSHDNKVQNICKVKSDNITIEKVEHRLKRKGSLSKSETIENSSVVGI
QNANNLKISKDEGMRSKISDNIDYKNKENLCIQTSFVGFQTASNKKVKISEEALIKSKEL
FRSLDEDGDHTATKKFKVNEGFIGFQTANKKPVKVSEEALAKSKKIFEDIDLNKAESGFD
PNVLISNKQAKISEAGFESGEKPQNCDQELKNHIKSKLKTNSIIKNNPKDTRDNKPNDKD
KDITQFELNIDDLLNTEVIKNFDESLHMEEIVKDTPKSKRSGSPILSCPRAKKKKFEPPR
TINRNIINNVEVPKTTHSYKFRDSYKRTKIYKLKDLKKNRITSRDIDIYILKYSFDNLLE
FRFRDQRNDIDSDVWGTDKIKEYFTDNVNIKIVPEGWVENHMRLIIWKLLCYETFFGESM
RNVCSVKNVLEQLKYRYDKELYKVERPALRRILERDDLSTKMMVLCVASIHEAGVSVRSV
TNDSKNVELLLTDGWYCLKARVDRMIEKLIVDRKIVVGMKLAIHGAELMNCDQGMSPWED
INSVRLKLSGNSTKRARWDARLGFHGNAAMLTPLSAVRLDGGKVSKLRVFVTRVYPTLYV
EKFEDGSTVTRSERLELLHQMKYEAEKQMQMEKLYEEVEKMIETESQDSEQLTQNYNLET
GSQIAKLMMKNQDPSELKATLTSSQVQRLNEHTHRQKEALIQKIQDKVKDLMKKRGINVS
RSVVPLMKIRVADLRDDVTTALITIWRPNESLHEVIREGAWIDVYNAVPTSIRYSEIQIS
AGRQSMFCKSKYKETDRQTILKHTLERKCYNIKDLQSSKTSPYNEIDTFGAIFLIEPENF
DSNKQLFQNIYISGINKDIISINFWGGIKKFGYENILNVGNVVACVNIQKRAGNTKSIPQ
YRATELSYFTKTPKYDTLKTYLTDFLKKYNKMDGVKFVRDCVALKNNYSNINNDVSPLRH
CSELSISRNKMFLDSPLTRNSHLNITGSALEPGFSEETMLRKKKESERRIDKLKKYGEPP
PLNQIHIRNRAHITPYKSPLISNDGSIRVANIDNDVASNKISSPVLNKTFVKINPVKLNF
NVDNNEEPESPPLSLDTS
Download sequence
Identical sequences A0A212EVR4
DPGLEAN12657-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]