SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN03372-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN03372-PA
Domain Number 1 Region: 36-317
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.08e-87
Family G proteins 0.000000526
Further Details:      
 
Domain Number 2 Region: 300-417
Classification Level Classification E-value
Superfamily Translation proteins 1.59e-23
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 3 Region: 471-548
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.96e-22
Family EF-G/eEF-2 domains III and V 0.00021
Further Details:      
 
Domain Number 4 Region: 673-758
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.68e-16
Family EF-G/eEF-2 domains III and V 0.0021
Further Details:      
 
Domain Number 5 Region: 546-671
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000493
Family Translational machinery components 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN03372-PA
Sequence length 767
Sequence
MKSFILVNTYRKLFGNAFLRRYYRLYSTEKIKEKNSIDKIRNIGILAHIDAGKTTTTERM
LFYSGTIRSMGEVHHGNTVTDYMEQERQRGITITSAAVSFPWRDHQINLIDTPGHIDFTM
EVELSLAVLDGAVVVLDGSAGVEAQTLTVWRQASGYKLPRIVYVNKLDRSDADAEACAIS
VQDKLHALPLLLHIPVKMDGRLVGLIDLVTLEEIIWTQGRGKNYTQRKLTEVSDGHKWEY
AINRHRRLIDTLSSIDDKLAETIIHQESLDNIQAKEIEDAIRRCTLDMKGFPVLCGSSYK
NIGVQTLIDGVISYLPSPSERTGVYNSFGNDLCARAFKVQHDDQRGVLTFLRLYSGEILK
GQKIYNVARGTSEQTGSLSVALADDYQPAESLAAGNIAVVSGLKTTMTGDLVTSSQSAAR
RAREKLVATLKDPRAQDDMLVPSARVKLQAMDTEPTTEEVADVMLGIGTSIPEPVFLCSI
EPPGPGQLGALETALEELVREDPSLRVHTDEDTGQMVLAGMGELHLEIIKERIIREYKID
VELGTPQISYREMLEGSAKDRLVVDRKIGNARQTVTVVLSAKTVRGVAADRVLKLDKTAE
SAANLAHVHPRTMSAVSRGVAARDASPGAEACPLVDTQVTLHWLEVGRGTSESVVSATVS
QCLRRVFSSAGSVLLEPVMFLQLVVPETHSARLLADLTRRRADQLQVTLRRDNKVIECVA
PLSRLVGYSAAVRSLSSGLASFSMQFYEYRQMSPHDEEEAVRDVTGF
Download sequence
Identical sequences A0A212EYL2
DPGLEAN03372-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]