SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN08785-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN08785-PA
Domain Number 1 Region: 389-484
Classification Level Classification E-value
Superfamily TAFH domain-like 1.7e-31
Family TAFH domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 726-771
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000418
Family TBP-associated factors, TAFs 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN08785-PA
Sequence length 932
Sequence
MASAEFLEQALSTDVDENAVNAIVGSLENHLVTSVPSISSQNNLLTVIPSQLSLATSENT
IIGQKYNKENSDGDIGSVNFRPNIVSSSSFSLPSTFINQTSLSQNISNGTDLVKVISSQP
LTLSVSDNSVVFSAPSYANGCPSLPLSQAQIIQTVQGSSAINQPINKSITMQNPPLVIKQ
GTTSGQVSMQANMVPMTVNSSMPGSISNVMTINKPGGQNVVVTTQNLGTGQPAILPNVQI
LNMRPGAPAVAAQKSVATVSPRVVIGTPQVVGQRAAAPGITLQTLQSLQQGQQGHLLLKT
ENGHYQLLRVGPGPGASTLAPQQQTMRLSTVPAHPGVSTVSTSVPAPVQIPGQMPQGPVA
TPVPAASVTVPLPSPQSLQPTVTTQKPLDNTKEKCRNFLANLLDLSSKEPKSVERSVRNL
IQELIDAQVEPEEFCDRLERLLNASPQPCLIGFLKKSLPLLRQSLVTKELVIEGINPPSP
HVAFSAISPQAPNTAVATSNIQMPGLTLVVRQPDDEGSSSPTLTPLLPPVMPVIPPQPPS
PKQINIVAVQSAQVCRSRYTSLSTSRVIGIIRYGGSTRDAALYITYMSIRLHHCALPHQP
KPQPKSGGTIAVLQNIPVHPKINVSKVGKTMTVNSKAGFTRPTGSANTGLSTVLTAGKSL
LRDRERRSAQFSQSFVDDKMAGDDDINDVAAMGGVNLAEESQRILGSTEMIGAQIRSCKD
ETLVPMAVMQARIRAVSLRHGLEEPPAEVGALLSHALQERLKSLLEKLAVISQHRIDTHV
KMDSRYEVTQDVKGQLKFLEELDRVDKKRREDSEREMLLRAAKSRSKNEDPEQAKLKAKA
KEMQRAELEELRQREANLTALQAIGPRKKPRTDGSAAGDNLGSSGQSTGPSGRGQLPQRT
RLKRVNMRDMLFMMEQEPEYRHSALLYRAYLK
Download sequence
Identical sequences A0A212EQJ8
DPGLEAN08785-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]