SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN10515-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN10515-PA
Domain Number 1 Region: 26-180,246-312,353-519
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.2e-47
Family Quinoprotein alcohol dehydrogenase-like 0.017
Further Details:      
 
Domain Number 2 Region: 484-626
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000235
Family Quinohemoprotein amine dehydrogenase B chain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN10515-PA
Sequence length 629
Sequence
MRMFIRGRPVVMYGPSDHENLDPAKVAPPPQSKLKLEWVYGYRGKDCRSNLYMLPTGEMV
YFVAAVVVLFNVEEQCQRHYTGHTDDVKSIAIHPNKLVIASGQCAGHDRLDARPHVRVWN
SVSLATLAVVGAGSLERAVSCLSFSRADGGNLLAVVDEGADRVLSVWDWQRADRGCLAET
KCSVDTVIAAEFHPLDRNQIVTCGKGHIAFWTLDASNVLYKRMGVFDTRDKPKYVTCLGF
NHNGDVISGDSSGSLTVWSRGTSVASRTVRGAHSGGVFSVCALREGGLLSAGGKDGRIVL
FDDELNATGTEAVIEGHYGGVRVVSEGRGRLLVGTTRNCILVGDLQLGFTPAVLGHVDEV
WGLATHPCLPQFVSAGWDRLLQLWDGMSHSTVWSKDIDERAQCCAWSSDGGVVAVGGCSG
RWMVYDPQTRALLADHRDGSEPIQTIVYSPNNQMVALGARDNFIYIYQVDDQGARYSRLG
KCVGHSSFITHLDWSEDSQYLRSNSGDYELLYWNASTCRQVTSPTSMRDITWASNHCPIT
FTTVGVWPEGADGTDINSCDKSSDNRLAVTGDDFGKVKLYAYPVTQPKSVCATYGGHSSH
VSCVRFSSDGTRVLSAGGRDAALMQWAVE
Download sequence
Identical sequences DPGLEAN10515-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]