SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DPGLEAN19345-PA from Danaus plexippus OGS1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DPGLEAN19345-PA
Domain Number 1 Region: 121-494
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.84e-65
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0058
Further Details:      
 
Domain Number 2 Region: 13-125
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 0.000000000000392
Family Lipovitellin-phosvitin complex, superhelical domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DPGLEAN19345-PA
Sequence length 1468
Sequence
MNIIGDSLIPVPTRLTAIDAFRRTPCTETREYFLETYRADLVDVEVRIASYLQVMKCPNL
STIRKIFHSLKKEPVNQVATFVWSHLNNLGQSSLPSRVEIQGLLSGNTVPQLEDSPDFRM
FSRNYEQSVFFDQYNAGGNYEANVIFSPDSYIPRSLSLNLTVDMFGESINLLEIKARGEG
FERYFENLFGNDGPLSKNKINDKISKMRFFRSTNEADDIREKIDDLEFNNNALKHRFPTA
ELGFKVFGNEISFWSAEGDEEIRKSLERLNPKLRILEILSGKEISYNKASLFLDTTFSVP
TGCGLPLGMNLMGTSYVDTKLSGNVVDKFSQSRNLDFEGKIRPSVAVNIAATMSVSAGSL
ANSGVRLSSRLYTATALEAKLSIRGLGVIRLDLSLPREKQEIFAAKSELLILHGDQEIQQ
QGLNKNRIEQNTCSWTTFDKAIGIKVCAAYQFPNMTNLKNAPYFILSGPAKYIVSLEKAD
PSANTYAFQYKWDKNDTTDVLDFSFDTPNSKEKRKFNAVLLLSNTSSIAEVTLLSSESTI
KAKALYRNMPYDKSLEASLDVDGRKQFDSVMALQRHDIKHGYVWLPHAYWVVNDQKIAEL
SGSIKVKSKGGVTQWDITADFQTKQLASRLIGYYTVNGPTQGTKLQLDYQFYKTAKQTIK
IEGVYSKRAMAYRYDVYGELSMQFTAYPIYNFYSVLRNVQTQNHLDIGLNVSSSKDLKHD
PAFTFVYKKVDKLNGLKLDTQMSLKRPRPVLMKFQYDQTGPKYSALALLNFNPKSREILI
SGYVFAPPGTQLYMDAELNVTLPTLHPCAIKTKLHEKRPNEFQVNAVGVWFTGVDFNIDA
VYQDTSKTNLASHRLKVLINSSHFKDIAVDARFTQDNRQITFIAEGEYNEDTYKSLVRYL
LLSEQNFTAYGEVDISGRAYSLNLNADLNNNTNVNMDIHFDQLRDVHISYQRSVTPTQKR
LSASLNWDANRDPSQKLSIDARLNHKGQWHHSGQVTLHYPGRVVNGEFEFLLKDWYCEWL
VRMGWASPTAVVWRVKAYSEAREETVYALLSNLATPLSGWEDTSFNVMWRYRDNLQAING
SMNWQEDYLAFSLLADYLFSTSKFYGEINASVNSTIPTLPRAAAVAKHTVVWKKSADTLL
SFQYNEDGLLMVNSSWAIDKGQNENNITGRVTLLTPFQGYTKGFLRTEFILGHKRDIKGV
TYLDLEEKVVKIYVNGHMRRITNCMLVVNVTSPIPQFSQTTARFGFVETDRHLVAMIVTP
NSTTGIEVLLQLNTMQDFSIFGHVALPIQYLNRAMITAKRGSEEVDFRVGWGTMDFGFTG
IWQWKNILNFVYVYKLYTPLDGFEENGLVLKNIYGNGLDTELSVRLSKHKFGISILLVDN
GKGLLDVIKDSFQHKAGDSDMFVENFDTEATINLDTLYYPTINFHAHMLKFVGPDEEDIL
EANATLHLPNKSPIVLTDVFILEVKYEV
Download sequence
Identical sequences DPGLEAN19345-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]