SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529232637|ref|YP_008393452.1| from Acetobacter pasteurianus 386B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529232637|ref|YP_008393452.1|
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.43e-23
Family Phosphate binding protein-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529232637|ref|YP_008393452.1|
Sequence length 249
Comment hypothetical protein APA386B_2700 [Acetobacter pasteurianus 386B]
Sequence
MTSLTLAYPETTVHEATAAAIIRVLEANDVEPDIVTGPKDVLTDMLKKGEVDFYVSAWLP
DEDAGMLAPGILPLGNLFRPAAHCCISAEDTPLTSLDDVAQAGPELSRTIITPASLRKHM
ENVLQQYGLDTAGFSLKVLPDEEALAELNAALKREELVLMPLFQPCFLFHIGGFRILNDP
KNALGGEQDARILIRAETKDEMEQDLLDELDELMLSAKIISAMDYAMRVEGMTADEAAEA
WQRGKLLPR
Download sequence
Identical sequences C7JH72 S6D6D0
gi|384050711|ref|YP_005477774.1| gi|384057053|ref|YP_005489720.1| gi|384062986|ref|YP_005483628.1| gi|384053819|ref|YP_005486913.1| gi|529232637|ref|YP_008393452.1| gi|258542273|ref|YP_003187706.1| gi|384042194|ref|YP_005480938.1| WP_004449115.1.36695 WP_004449115.1.37930 WP_004449115.1.38618 WP_004449115.1.45580 WP_004449115.1.55019 WP_004449115.1.62313 WP_004449115.1.64431 WP_004449115.1.65311 WP_004449115.1.71918 WP_004449115.1.88241 WP_004449115.1.96488 WP_004449115.1.99323 634452.APA01_11790 gi|384059694|ref|YP_005498822.1| gi|384119062|ref|YP_005501686.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]