SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00002085 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00002085
Domain Number 1 Region: 431-560
Classification Level Classification E-value
Superfamily Plus3-like 1.57e-42
Family Plus3 0.00000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00002085
Sequence length 776
Sequence
MGKRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRKKPQTAAKSSSRSDSDSDWANNKA
GAPASKKKKRQKASRDSSSSESNWDDDSQDEEQPARQSPAQAQQEQKPPEQATQPAHLSE
QEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSSDSEFDDGFDDDLMGDEEDRRRLNALSE
KERETEIYKRIEQREFMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKAKK
AREAQAAAPPQASISTLSDAEPKPSGEVRSASPLSSPALSRDVASTSAAVASILPDDQAA
AAGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKRECKAKREEEEAKRLAERDR
DDDKEELESVSGCKSAVKLKASEIYSDDSGSSDWDEDEKPTGKRSRSNSSKASSESEDDE
KVPQRPVFITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAE
IVGVVETGKVYSLGTTRTNRGLRLKHGTHERVFRLEFISNQDFTESEFNKWNEVCQQGHV
QMPTIDLIATKQTDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAM
LRGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDAEKAILEEAR
ANKGLKISDPFTRRITQPRMGFKGAKKDDDDLQLAPLPPPPPGKKRPNEAGTSSASTKPT
DAKDFSLYSLHDFDIDLDVPLPVSTNAVPKPANKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences DS10_00002085 XP_016930339.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]