SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00002449 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00002449
Domain Number 1 Region: 90-257
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 5.1e-39
Family Bcl-2 inhibitors of programmed cell death 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00002449
Sequence length 298
Sequence
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRR
RLSNVSDAVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRVYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTTNSLNPLEWTTLIIGVVFGLILVFMVLRFIINMIIPKIYQRFTN
Download sequence
Identical sequences XP_016928876.1.48971 DS10_00002449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]