SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00005579 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00005579
Domain Number 1 Region: 96-273
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 7.89e-43
Family Bcl-2 inhibitors of programmed cell death 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) DS10_00005579
Sequence length 302
Sequence
MAPTTSPPPKLAKFKSSSLDHEIYTANRRGTIATASSDWKALRGGGVGVGGIGGGGPGTH
PSNGRSLHAGGAMTRAASTSSLASSTRTMTNYQEYKMEIINQGKCLCGQYIRARLRRAGV
LNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELED
SDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIE
DDLVYWLIDNGGWMGLSRHIRPRVGEFTFLGWLTLFVTISAGAYMVSNVCKRIGGQLYSL
LF
Download sequence
Identical sequences DS10_00005579 XP_016940858.1.48971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]