SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00006064 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00006064
Domain Number 1 Region: 52-181
Classification Level Classification E-value
Superfamily Plus3-like 1.57e-36
Family Plus3 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) DS10_00006064
Sequence length 265
Sequence
MSGQPFRRTRRPAAEIVRELRHLRSSPLRIDDEDESWVEGHEKPPTPDLPVVSRDQLEQL
RLSRHRIGLLLVRPAFEQAVTGCFVRVNINGQEELPDHRIAEVLGLGELDFGYKVGEVPT
NVALRLRYEDLVMLHEINDVSNLAFTKEEFELWRDICINQAISPPTTHMITRKKIELYNA
LQCEAKPLSLIQRTFSFALKPPQKRGIMERHGNVYPWRLKHPLPLIPQPPPMPPPENPPR
GLTYRMKTSSLVLDLEGEKNTGAAN
Download sequence
Identical sequences XP_016942124.1.48971 DS10_00006064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]