SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00010129 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00010129
Domain Number 1 Region: 306-363
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.45e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000196
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0005
Further Details:      
 
Weak hits

Sequence:  DS10_00010129
Domain Number - Region: 210-308
Classification Level Classification E-value
Superfamily ARM repeat 0.000662
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00010129
Sequence length 363
Sequence
MALCQTSVLKVYHAVIEDVITNVRDAFLDDGVDEQVLQEMKQIWRNKLLASKAVELSPDS
SDGSHPPPIVANNPKAANAKAKKAAAASAATSQPQIGGSSSAASLAALKSPAGMATGSGI
KNGLVPIKQEVNSQNPPPLHPTSGAAMMQKQQQAASSGQGSIPIVATLDPNRIMPVNITL
PSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVNAAL
SNANHQKNLAASKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDVEHEDAAEEEP
LNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKSNGD
AEW
Download sequence
Identical sequences XP_016943750.1.48971 DS10_00010129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]