SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for DS10_00004779 from Drosophila suzukii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  DS10_00004779
Domain Number 1 Region: 41-276
Classification Level Classification E-value
Superfamily L domain-like 3.61e-37
Family Ngr ectodomain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 275-376
Classification Level Classification E-value
Superfamily Immunoglobulin 6.72e-16
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) DS10_00004779
Sequence length 846
Sequence
MMITRTEANGRLGILLLGAAMLLLLLPLVTATSDWMQSCGPCHCHWNSGKKSADCKNKAL
TKIPLDMSNEMQVLDFAHNQIPELRREEFLLAGLPNVHKVYLRNCTIQEVHREAFKGLHI
LIELDMSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSYLSRIEFRNNRLR
QVQLHVFAGTVALSAISLEQNRLAHLHKETFKDLQKLMHLSLQGNAWNCSCELQDFRDFA
IQKRLYTPPTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFVEANHDNISLPCRIVG
SPRPNVTWVYNKRPLQQYDPRVRVLTSVEQLPEQPAQVLTSELRIVGVRASDKGAYTCVA
DNRGGRAEAEFQLLVSGDYAGAVSASDGHGMGGMGAIGAPTIDPQTNVFLIICLITTTLL
LLLIVVVLALFWYCRRIKTYQKDTTMMSGDGLISSKLDKTHNGSMLEGSVIMEMQKSLLN
EVNPVEKPPRRTDIESVDGGDDVLEIKKTLLDETVYVANHSRDEEAHSVALSDTTIPPRS
RHTYVDDAYANSLPPDLLAFPARVPPTSPSMQSSQSNIPDQVIYGIRSPPSLTSPVYTHM
TPHGIYGTKTLAAPHNGFMTLQHPKSRNLALIATANSSRQHQHQHLLQQQQQQQQHQQQP
HPLATTSPFLPAPVVYSPATGVVMKQGYMTIPRKPRAPSWAPSTSGAAGHGTIQLSEFQS
PTSPNPSETGTATTAELQAEPVYDNLGLRTTAGGNSTLNLTKIAGSGSASGSGSGSQGGQ
QYSMRDPAVSPSHAGSSSGDSPKAAKIPPRPPPKPKKKVMSVTTTRSGQGSTSQLFDDEG
EDGTEV
Download sequence
Identical sequences DS10_00004779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]